Copy Link Print Information

VNN2/Vanin-2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

VNN2/Vanin-2 Proteinas, an amidohydrolase, crucially hydrolyzes D-pantetheine's carboamide linkage, recycling pantothenic acid and releasing cysteamine. Apart from its vitamin metabolism role, VNN2 is involved in thymus homing of bone marrow cells and may regulate beta-2 integrin-mediated processes, influencing neutrophil adhesion, migration, and motility. VNN2/Vanin-2 Protein, Human (HEK293, His) is the recombinant human-derived VNN2/Vanin-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for VNN2/Vanin-2 Protein, Human (HEK293, His)
  • VNN2/Vanin-2 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

VNN2/Vanin-2 Proteinas, an amidohydrolase, crucially hydrolyzes D-pantetheine's carboamide linkage, recycling pantothenic acid and releasing cysteamine. Apart from its vitamin metabolism role, VNN2 is involved in thymus homing of bone marrow cells and may regulate beta-2 integrin-mediated processes, influencing neutrophil adhesion, migration, and motility. VNN2/Vanin-2 Protein, Human (HEK293, His) is the recombinant human-derived VNN2/Vanin-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Vanin-2 (VNN2) is an amidohydrolase that specifically hydrolyzes one of the carboamide linkages in D-pantetheine, playing a crucial role in the recycling of pantothenic acid (vitamin B5) and releasing cysteamine. Beyond its role in vitamin metabolism, VNN2 is involved in the thymus homing of bone marrow cells. Additionally, it may play a regulatory role in beta-2 integrin-mediated processes, influencing cell adhesion, migration, and the motility of neutrophils.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    O95498-1 (Q23-S492)

  • Gene ID
    8875  [NCBI]
  • Molecular Construction
    • N-term
    • VNN2 (Q23-S492)
      Accession # O95498
    • 6*His
    • C-term
  • Protein Length

    Full Length of Pantetheine hydrolase VNN2 Chain

  • Synonyms

    VNN2; Vanin 2; FOAP-4; GPI-80; Glycosylphosphatidyl Inositol-Anchored Protein GPI-80; Vascular Non-Inflammatory Molecule 2; Pantetheine Hydrolase VNN2; Pantetheinase; cDNA FLJ55137, Highly Similar To Vascular Non-Inflammatory Molecule 2; Protein FOAP-4; Vannin 2; Vanin-2

  • AA Sequence

    QDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDILETAIKQAAEQGARIIVTPEDALYGWKFTRETVFPYLEDIPDPQVNWIPCQDPHRFGHTPVQARLSCLAKDNSIYVLANLGDKKPCNSRDSTCPPNGYFQYNTNVVYNTEGKLVARYHKYHLYSEPQFNVPEKPELVTFNTAFGRFGIFTCFDIFFYDPGVTLVKDFHVDTILFPTAWMNVLPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTGSGIYAPNGPKVYHYDMKTELGKLLLSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTELFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGAFTGLHGRRRREYWQVCTLLKCKTTNLTTCGRPVETASTRFEMFSLSGTFGTEYVFPEVLLTEIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLYSS

  • Predicted Molecular Mass

    54 kDa

  • Molecular Weight

    Approximately 55-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • VNN2/Vanin-2 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for VNN2/Vanin-2 Protein, Human (HEK293, His)
  • VNN2/Vanin-2 Protein, Human (HEK293, His) Product Image