Vpr Protein, HIV-1 group M subtype C (His, Myc)

Vpr Protein, HIV-1 group M subtype C (His, Myc) is the recombinant virus-derived Vpr protein, expressed by E. coli, with N-10*His & C-Myc tag.

Vpr is a protein that may deplete host UNG protein and induce G2-M cell cycle arrest during virus replication. It targets specific host proteins for degradation by the 26S proteasome through association with the cellular CUL4A-DDB1 E3 ligase complex by direct interaction with host VPRPB/DCAF-1. Cell cycle arrest reportedly occurs within hours of infection and is not blocked by antiviral agents, suggesting it is initiated by Vpr carried into the virion. Additionally, Vpr induces apoptosis in a cell cycle-dependent manner, indicating these two effects are mechanistically linked. Detected in the serum and cerebrospinal fluid of AIDS patients, Vpr may also induce bystander cell death.

Virus

E. coli

N-10*His;C-Myc

O12160(M1-S96)

Full Length

MEQAPEDQGPQREPYNEWTLELLEELKREAVRHFPRPWLHGLGQHIYETYGDTWTGVEAIIRILQRLLFVHFRIGCQHSRIGILRQRRARNGASRS

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.