WIBG Protein, Human (His)
WIBG is a central regulator of the exon junction complex (EJC) and serves as a critical EJC disassembly factor in post-transcriptional processes. WIBG is located upstream of exon-exon junctions on mRNA and destroys mature EJCs on spliced mRNAs during translation, thereby promoting the removal and recycling of EJCs. WIBG Protein, Human (His) is the recombinant human-derived WIBG protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
WIBG is a central regulator of the exon junction complex (EJC) and serves as a critical EJC disassembly factor in post-transcriptional processes. WIBG is located upstream of exon-exon junctions on mRNA and destroys mature EJCs on spliced mRNAs during translation, thereby promoting the removal and recycling of EJCs. WIBG Protein, Human (His) is the recombinant human-derived WIBG protein, expressed by E. coli , with C-6*His labeled tag.
WIBG, a pivotal regulator of the exon junction complex (EJC), plays a central role in post-transcriptional processes within the cytoplasm, serving as a key component of the EJC, which associates immediately upstream of the exon-exon junction on mRNAs. Functioning as an EJC disassembly factor, WIBG facilitates translation-dependent EJC removal and recycling by disrupting mature EJC from spliced mRNAs. Its interaction with the 40S ribosomal subunit likely prevents translation-independent EJC disassembly, confining its activity to translated mRNAs. WIBG's involvement interferes with nonsense-mediated mRNA decay (NMD) and enhances the translation of spliced mRNAs, potentially through its antagonistic role against EJC functions. While its RNA-binding capability has been detected, the in vivo relevance of this interaction remains unclear. WIBG's direct interaction with MAGOH and RBM8A, along with its association with the 40S ribosomal subunit and the 48S preinitiation complex, underscores its intricate involvement in orchestrating post-transcriptional regulatory processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q9BRP8 (M1-L204)
-
Molecular Construction
-
N-term
-
WIBG (M1-L204)
Accession # Q9BRP8 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
PYM1; Partner Of Y14 And Mago; Prev. WIBG; PYM Homolog 1 Exon Junction Complex-Associated Factor; PYM Homolog 1, Exon Junction Complex Associated Factor; Within Bgcn Homolog (Drosophila); PYM; Within Bgcn Homolog; PYM1 Exon Junction Complex Associated Fac
-
AA Sequence
MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL
-
Predicted Molecular Mass
23.7 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)