WIBG Protein, Human (His)

WIBG is a central regulator of the exon junction complex (EJC) and serves as a critical EJC disassembly factor in post-transcriptional processes. WIBG is located upstream of exon-exon junctions on mRNA and destroys mature EJCs on spliced mRNAs during translation, thereby promoting the removal and recycling of EJCs. WIBG Protein, Human (His) is the recombinant human-derived WIBG protein, expressed by E. coli , with C-6*His labeled tag. The total length of WIBG Protein, Human (His) is 204 a.a., with molecular weight of 16-30 kDa.

WIBG, a pivotal regulator of the exon junction complex (EJC), plays a central role in post-transcriptional processes within the cytoplasm, serving as a key component of the EJC, which associates immediately upstream of the exon-exon junction on mRNAs. Functioning as an EJC disassembly factor, WIBG facilitates translation-dependent EJC removal and recycling by disrupting mature EJC from spliced mRNAs. Its interaction with the 40S ribosomal subunit likely prevents translation-independent EJC disassembly, confining its activity to translated mRNAs. WIBG's involvement interferes with nonsense-mediated mRNA decay (NMD) and enhances the translation of spliced mRNAs, potentially through its antagonistic role against EJC functions. While its RNA-binding capability has been detected, the in vivo relevance of this interaction remains unclear. WIBG's direct interaction with MAGOH and RBM8A, along with its association with the 40S ribosomal subunit and the 48S preinitiation complex, underscores its intricate involvement in orchestrating post-transcriptional regulatory processes.

Human

E. coli

C-6*His

Q9BRP8 (M1-L204)

84305  [NCBI]

MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL

16-30 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.