WIF-1 Protein, Human (HEK293, His)

WIF-1 protein critically binds to WNT protein, inhibits its activity and regulates the WNT signaling pathway. In addition to its inhibitory role, WIF-1 may also contribute to mesoderm segmentation, implicating its role in embryonic development. WIF-1 Protein, Human (HEK293, His) is the recombinant human-derived WIF-1 protein, expressed by HEK293 , with C-6*His labeled tag.

The WIF-1 protein plays a crucial role as it binds to WNT proteins, effectively inhibiting their activities. This interaction suggests a pivotal regulatory function in WNT signaling pathways. Beyond its inhibitory role, WIF-1 may also be involved in mesoderm segmentation, hinting at its potential contributions to embryonic development. Furthermore, WIF-1 interacts with MYOC, indicating a possible association with additional cellular processes or signaling cascades. The multifaceted interactions of WIF-1 underscore its importance in modulating WNT-mediated activities and its potential involvement in broader developmental and cellular events.

1.Measured by its ability to inhibit Wnt-3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED₅₀ this effect is 0.1022-0.1136 μg/mL in the presence of 20 ng/mL Recombinant Human Wnt-3a, corresponding to a specific activity is 8802.8169-9784.7358 units/mg.
2.Measured by its ability to inhibit Wnt-3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED₅₀ for this effect is ≤0.5 μg/mL in the presence of 10 ng/mL Recombinant Human Wnt-3a, corresponding to a specific activity is ≥2×10³ U/mg.

• 
  Measured by its ability to inhibit Wnt-3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED₅₀ for this effect is 0.1022 μg/mL in the presence of 20 ng/mL Recombinant Human Wnt-3a, corresponding to a specific activity is 9784.7358 units/mg.

Human

HEK293

C-6*His

AAH18037.1 (G29-W379)

11197  [NCBI]

Partial

GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW

Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Glycine-HCl, 10% sucrose, 5% mannitol , 0.05% Tween 80, pH 3.5.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.