ZG16 Protein, Human (HEK293, His)

The ZG16 protein has a potential role in protein transport and serves as a linker molecule during trans-Golgi network (TGN) particle formation. Its involvement suggests a dynamic role in intracellular protein transport. ZG16 Protein, Human (HEK293, His) is the recombinant human-derived ZG16 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ZG16 Protein, Human (HEK293, His) is 151 a.a., with molecular weight of ~16.0 kDa.

ZG16 protein is implicated in potentially playing a role in protein trafficking, specifically functioning as a linker molecule during granule formation within the trans-Golgi network (TGN). Its potential involvement in protein trafficking suggests a role in the dynamic process of transporting proteins within the cell. Notably, ZG16 may act as a crucial linker between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins, emphasizing its significance in the intricate process of granule formation. The precise mechanisms and molecular interactions through which ZG16 orchestrates protein trafficking and facilitates granule formation merit further investigation to elucidate its functional contributions in cellular processes related to protein transport and secretion.

Human

HEK293

C-6*His

O60844 (N17-C167)

653808  [NCBI]

NAIQARSSSYSGEYGGGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLLFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPSSCSRC

Approximately 16.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.