1. Recombinant Proteins
  2. Others
  3. ZG16 Protein, Human (HEK293, His)

The ZG16 protein has a potential role in protein transport and serves as a linker molecule during trans-Golgi network (TGN) particle formation. Its involvement suggests a dynamic role in intracellular protein transport. ZG16 Protein, Human (HEK293, His) is the recombinant human-derived ZG16 protein, expressed by HEK293 , with C-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The ZG16 protein has a potential role in protein transport and serves as a linker molecule during trans-Golgi network (TGN) particle formation. Its involvement suggests a dynamic role in intracellular protein transport. ZG16 Protein, Human (HEK293, His) is the recombinant human-derived ZG16 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

ZG16 protein is implicated in potentially playing a role in protein trafficking, specifically functioning as a linker molecule during granule formation within the trans-Golgi network (TGN). Its potential involvement in protein trafficking suggests a role in the dynamic process of transporting proteins within the cell. Notably, ZG16 may act as a crucial linker between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins, emphasizing its significance in the intricate process of granule formation. The precise mechanisms and molecular interactions through which ZG16 orchestrates protein trafficking and facilitates granule formation merit further investigation to elucidate its functional contributions in cellular processes related to protein transport and secretion.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH29149.1 (N17-C167)

Gene ID
Molecular Construction
N-term
ZG16 (N17-C167)
Accession # AAH29149.1
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Zymogen Granule Membrane Protein 16; Zymogen Granule Protein 16; hZG16; Secretory Lectin ZG16; ZG16
AA Sequence

NAIQARSSSYSGEYGGGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLLFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPSSCSRC

Predicted Molecular Mass
17.7 kDa
분자량

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM His-HCl, 10% trehalose, 50 mM NaCl, 0.05% Tween 80, 1 mM EDTA, pH 6.0.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

ZG16 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

ZG16 Protein, Human (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
ZG16 Protein, Human (HEK293, His)
Cat. No.:
HY-P71037
수량:
MCE Japan Authorized Agent: