Copy Link Print Information

ZG16 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The ZG16 protein has a potential role in protein transport and serves as a linker molecule during trans-Golgi network (TGN) particle formation. Its involvement suggests a dynamic role in intracellular protein transport. ZG16 Protein, Human (HEK293, His) is the recombinant human-derived ZG16 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • ZG16 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The ZG16 protein has a potential role in protein transport and serves as a linker molecule during trans-Golgi network (TGN) particle formation. Its involvement suggests a dynamic role in intracellular protein transport. ZG16 Protein, Human (HEK293, His) is the recombinant human-derived ZG16 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

ZG16 protein is implicated in potentially playing a role in protein trafficking, specifically functioning as a linker molecule during granule formation within the trans-Golgi network (TGN). Its potential involvement in protein trafficking suggests a role in the dynamic process of transporting proteins within the cell. Notably, ZG16 may act as a crucial linker between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins, emphasizing its significance in the intricate process of granule formation. The precise mechanisms and molecular interactions through which ZG16 orchestrates protein trafficking and facilitates granule formation merit further investigation to elucidate its functional contributions in cellular processes related to protein transport and secretion.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    AAH29149.1 (N17-C167)

  • Gene ID
    653808  [NCBI]
  • Molecular Construction
    • N-term
    • ZG16 (N17-C167)
      Accession # AAH29149.1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    ZG16; Zymogen Granule Protein 16; JCLN; HZG16; JCLN1; ZG16A; Jacalin-Like Lectin Domain Containing; Zymogen Granule Membrane Protein 16; Secretory Lectin ZG16; Zymogen Granule Protein 16 Homolog (Rat); Zymogen Granule Protein 16 Homolog

  • AA Sequence

    NAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC

  • Predicted Molecular Mass

    17.7 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM His-HCl, 10% trehalose, 50 mM NaCl, 0.05% Tween 80, 1 mM EDTA, pH 6.0.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • ZG16 Protein, Human (HEK293, His) Product Image
    1/16
  • ZG16 Protein, Human (HEK293, His) Product Image