STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Cat. No.: HY-P3141 Pureza: 95.28%: Ficha de datos
COA

SDS
Instrucciones de manejo
FAQs
Technical Support

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.

Para uso exclusivo en investigación. No vendemos a pacientes.

Síntesis de péptidos personalizados

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN Estructura química

Tamaño	Stock	Cantidad
5 mg	En stock	Estimated Time of Arrival: December 31
10 mg	Obtener un presupuesto	Estimated Time of Arrival: December 31
50 mg	Obtener un presupuesto
100 mg	Obtener un presupuesto

or Consulta para venta a granel

* Seleccione Cantidad antes de agregar artículos.

This product is a controlled substance and not for sale in your territory.

Revisión del cliente

Based on 1 Customer Validation

Recomendaciones destacadas

•Related Small Molecules:

•Related Proteins:

Actividad biológica
Pureza y Documentación
Referencias
Revisión del cliente

Descripciòn

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2^[1].

Peso molecular

3649.88

Fòrmula

C₁₆₄H₂₃₈N₄₀O₅₅

Appearance

Solid

Color

White to off-white

Sequence

Ser-Thr-Ile-Glu-Glu-Gln-Ala-Lys-Thr-Phe-Leu-Asp-Lys-Phe-Asn-His-Glu-Ala-Glu-Asp-Leu-Phe-Tyr-Gln-Ser-Ser-Leu-Ala-Ser-Trp-Asn

Sequence Shortening

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Envío

Room temperature in continental US; may vary elsewhere.

Almacenamiento

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvente y solubilidad

In Vitro:

H₂O

Peptide Solubility and Storage Guidelines:

1. Calculate the length of the peptide.

2. Calculate the overall charge of the entire peptide according to the following table:

	Contents	Assign value
Acidic amino acid	Asp (D), Glu (E), and the C-terminal -COOH.	-1
Basic amino acid	Arg (R), Lys (K), His (H), and the N-terminal -NH₂	+1
Neutral amino acid	Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q)	0

3. Recommended solution:

Overall charge of peptide	Details
Negative (<0)	1. Try to dissolve the peptide in water first. 2. If water fails, add NH₄OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0)	1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0)	1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.

Pureza y Documentación

Purity: 95.28%

Select Batch:

Ficha de datos (258 KB) SDS (252 KB)

COA (256 KB) RP-HPLC (139 KB) MS (204 KB)

Instrucciones de manejo (2659 KB)

Referencias

[1]. Robson B, et, al. COVID-19 Coronavirus spike protein analysis for synthetic vaccines, a peptidomimetic antagonist, and therapeutic drugs, and analysis of a proposed achilles' heel conserved region to minimize probability of escape mutations and drug resistance. Comput Biol Med. 2020 Jun;121:103749. [Content Brief]