STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Customer Review

Based on 1 Customer Validation

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.

For research use only. We do not sell to patients.

  • Purity : 95.28%
  • Formula: C164H238N40O55
  • Molecular Weight:3649.88
  • Storage:

    Sealed storage, away from moisture.

    Powder   -80°C, 2 years , -20°C, 1 year

    * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

  • Biological Activity
  • Chemical Information
  • Solvent & Solubility
  • Purity & Documentation
  • References
  • Help & FAQs
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00