Tat-peptide 190-208 TFA 

Tat-peptide 190-208 TFA is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 TFA increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 TFA likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 TFA can be used for ischemic protection during endovascular repair for intracranial aneurysms^[1].

Tat-peptide 190-208 TFA (10 μM, 20 μM; 24 h) increases axon length in dissociated DRG cultures with 10 μM, as well as in iMotor neurons with 20 μM^[1].
Tat-peptide 190-208 TFA (10 μM; 3 d) increases the overall number of neurites extended from each neuron^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

3393.45 (free base)

C₁₄₂H₂₁₄N₄₀O₅₇·xC₂HF₃O₂

Solid

White to off-white

Tyr-Gly-Asn-Lys-Lys-Asn-Asn-Gln-Asn-Asn-Asn-Val-Ala-Glu-Pro-Glu-Pro-Asp-Pro-Glu-Pro-Glu-Pro-Glu-Gln-Glu-Pro-Val-Ser-Glu

YGNKKNNQNNNVAEPEPDPEPEPEQEPVSE

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture and light, under nitrogen

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

• [1]. Sahoo PK, et al. Axonal G3BP1 stress granule protein limits axonal mRNA translation and nerve regeneration.  [Content Brief]