β-Amyloid (1-40) (TFA)  (Synonyms: Amyloid Beta-Peptide (1-40) (human) TFA; Amyloid β-Peptide (1-40) (human) TFA)

β-Amyloid (1-40) TFA is a primary protein in plaques found in the brains of patients with Alzheimer's disease^[1].

β-Amyloid (1-40) and (1-42) are major components of senile plaque amyloids, are physiological peptides present in the brain, cerebrospinal fluid (CSF) and plasma. The levels of CSF β-Amyloid (1-40) and (1-42) show a U-shaped natural course in normal aging^[1].
The further aggregation of β-Amyloid (1-40)
1. Solid Aβ peptide was dissolved in cold hexafluoro-2-propanol (HFIP). The peptide was incubated at room temperature for at least 1h to establish monomerization and randomization of structure.
2. The HFIP was removed by evaporation, and the resulting peptide was stored as a film at -20 or -80°C.
3. The resulting film was dissolved in anhydrous DMSO at 5 mM and then diluted into the appropriate concentration and buffer (serum- and phenol red-free culture medium) with vortexing.
4. Next, the solution was age 48h at 4-8°C. The sample was then centrifuged at 14000g for 10 min at 4-8°C; the soluble oligomers were in the supernatant. The supernatant was diluted 10-200-fold for experiments.
Methods vary depends on the downstream applications.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4443.84

C₁₉₄H₂₉₅N₅₃O₅₈S.C₂HF₃O₂

Solid

White to off-white

Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture and light

*The compound is unstable in solutions, freshly prepared is recommended.

* Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

• [1]. Shoji M, et al. Cerebrospinal fluid Abeta40 and Abeta42: natural course and clinical usefulness. Front Biosci. 2002 Apr 1;7:d997-1006.  [Content Brief]