1. Neuronal Signaling
  2. Amyloid-β

Amyloid β Peptide (42-1)(human) 

Cat. No.: HY-P1362 Purity: 95.13%
Handling Instructions

Amyloid β Peptide (42-1)(human) is the inactive form of Amyloid β Peptide (1-42). Amyloid β Peptide (42-1) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease. Sequence: Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp ;AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD .

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Amyloid β Peptide (42-1)(human) Chemical Structure

Amyloid β Peptide (42-1)(human) Chemical Structure

CAS No. : 317366-82-8

Size Price Stock Quantity
1 mg USD 295 In-stock
Estimated Time of Arrival: December 31
5 mg   Get quote  
10 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Technical Information

  • Purity & Documentation

  • References


Amyloid β Peptide (42-1)(human) is the inactive form of Amyloid β Peptide (1-42). Amyloid β Peptide (42-1) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease. Sequence: Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp ;AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD .

Solvent & Solubility
In Vitro: 

10 mM in DMSO

Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2215 mL 1.1077 mL 2.2153 mL
5 mM 0.0443 mL 0.2215 mL 0.4431 mL
10 mM 0.0222 mL 0.1108 mL 0.2215 mL
*Please refer to the solubility information to select the appropriate solvent.
Molecular Weight






Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name



Applicant name *


Email address *

Phone number *


Organization name *

Country or Region *


Requested quantity *


Bulk Inquiry

Inquiry Information

Product Name:
Amyloid β Peptide (42-1)(human)
Cat. No.:

Amyloid β Peptide (42-1)(human)

Cat. No.: HY-P1362