1. Neuronal Signaling
  2. Amyloid-β

Amyloid β Peptide (42-1)(human) 

Cat. No.: HY-P1362 Purity: 95.13%
Handling Instructions

Amyloid β Peptide (42-1)(human) is the inactive form of Amyloid β Peptide (1-42). Amyloid β Peptide (42-1) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Amyloid β Peptide (42-1)(human) Chemical Structure

Amyloid β Peptide (42-1)(human) Chemical Structure

CAS No. : 317366-82-8

Size Price Stock Quantity
1 mg USD 295 In-stock
Estimated Time of Arrival: December 31
5 mg   Get quote  
10 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Technical Information

  • Purity & Documentation

  • References

Description

Amyloid β Peptide (42-1)(human) is the inactive form of Amyloid β Peptide (1-42). Amyloid β Peptide (42-1) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease.

References
Molecular Weight

4514.04

Formula

C₂₀₃H₃₁₁N₅₅O₆₀S

CAS No.

317366-82-8

Sequence

Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp

Sequence Shortening

AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

Storage
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Amyloid β Peptide (42-1)(human)
Cat. No.:
HY-P1362
Quantity:

Amyloid β Peptide (42-1)(human)

Cat. No.: HY-P1362