β-Amyloid (42-1), human  (Synonyms: Amyloid β Peptide (42-1)(human))

β-Amyloid (42-1), human is the inactive form of Amyloid β Peptide (1-42). Its active form, β-Amyloid (1-42), may play a key role in the pathogenesis of Alzheimer's disease^[1].

Note:
Please do not refer to only one article to determine the experimental conditions. It is recommended to determine the optimal experimental conditions (animal strain, age, dosage, frequency and cycle, detection time and indicators, etc.) through preliminary experiments before the formal experiment.

β-Amyloid (42-1), human is the inactive form of β-Amyloid (1-42). β-Amyloid (1-42) can be used in animal models to construct Alzheimer's disease models.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4514.04

C₂₀₃H₃₁₁N₅₅O₆₀S

317366-82-8

Solid

White to off-white

Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp

AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

• [1]. Schilling T, et al. Amyloid-β-induced reactive oxygen species production and priming are differentially regulated by ion channels in microglia. J Cell Physiol. 2011 Dec;226(12):3295-302.  [Content Brief]