1. GPCR/G Protein
  2. Glucagon Receptor
  3. GLP-2(1-33)(human)

GLP-2(1-33)(human) (Synonyms: GLP-2 (human); Glucagon-like peptide 2 (human))

Cat. No.: HY-P1024 Purity: 99.28%
Handling Instructions

GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GLP-2(1-33)(human) Chemical Structure

GLP-2(1-33)(human) Chemical Structure

CAS No. : 223460-79-5

Size Price Stock Quantity
500 μg USD 180 In-stock
Estimated Time of Arrival: December 31
1 mg USD 300 In-stock
Estimated Time of Arrival: December 31
5 mg USD 1140 In-stock
Estimated Time of Arrival: December 31
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.

IC50 & Target

GLP-2 receptor[1]

In Vitro

GLP-2-treated group demonstrates a 518±22% increase (P<0.05) in mucosal IGFBP-4 mRNA levels as compare with vehicle-treated controls. Because the mucosal expression of IGFBP-4 transcripts is found to be very low relative to that of the whole intestine, FRIC cultures are used as an in vitro model of the entire intestine. FRIC cultures have previously been established to express a functional GLP-2 receptor (GLP-2R) that displays a cAMP response, as well as enhances IGF-1 mRNA expression and IGF-1 secretion in response to GLP-2 treatment. When incubates with GLP-2 (10−8 M) for 2 hours, IGFBP-4 mRNA expression in the FRIC cultures is also found to be increased, by 40.8±15.2% (P<0.05), compare with vehicle-treated cells[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

GLP-2 quickly increases apoB48 mass in the TRL fraction of plasma, which is indicative of chylomicron number, and this is blocked by L-NAME. GLP-2 treatment alone increases postprandial TRL-lipids (slope 3.65±0.73×10−3 g/L/min vs 1.63±0.28×10−3 g/L/min, GLP-2 vs control), and this effect is completely mitigated by L-NAME pretreatment (slope 3.67±0.15×10−4 g/L/min). The GLP-2-induced rise in TRL-apoB48 occurres within 30 minutes and precedes the rise in TRL-TG. GLP-2 acutely increases plasma tritium levels (slope, 1.66±0.25×102 dpm/mL/min vs 1.11±0.17×102 dpm/mL/min, GLP-2 vs control)[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3766.19

Formula

C₁₆₅H₂₅₄N₄₄O₅₅S

CAS No.
Sequence

His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp

Sequence Shortening

HADGSFSDEMNTILDNLAARDFINWLIQTKITD

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Protect from light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (protect from light)

References
Cell Assay
[1]

Fetal rat intestinal cells (FRICs) are collected by enzymatical digestion of whole fetal rat intestines (mixed sex) and cultured overnight in DMEM containing 4.5 g/L glucose, 5% fetal bovine serum, and 40 U/mL penicillin and 40 μg/mL streptomycin in 10 cm plates. Cells are then treated with GLP-2 (10−8 M) or vehicle in low-glucose DMEM with 0.5% FBS for 0.5 to 24 hours[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Administration
[2]

Hamsters that undergo intraduodenal catheterization (idc) are allowed 7 days of recovery before jugular vein catheterization. For postprandial experiments, conscious fasted (16 h) hamsters receive a 75 mmol/kg iv bolus of L-NAME. After 10 minutes, baseline blood sample is collected (time 0), followed by an oralgastric gavage of 3 μL Ci [9,10-3H(N)] triolein in 200 μL olive oil. At t=10 minutes, F-127 is given ip (1 g/kg) to inhibit peripheral TG-rich lipoprotein (TRL) catabolism. At t=20 minutes, the hamsters receive ip injections of either PBS or 0.25 mg/kg human GLP-2(1-33). Blood (400 μL) is collected every 30 minutes for 2 hours. Blood is centrifuged at 6000 rpm for 10 minutes at 4°C to isolate plasma. Radioactivity is assessed using a liquid scintillation counter[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

GLP-2(1-33)(human)GLP-2 (human) Glucagon-like peptide 2 (human)Glucagon ReceptorGCGRInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP-2(1-33)(human)
Cat. No.:
HY-P1024
Quantity:
MCE Japan Authorized Agent: