GLP-2(1-33)(human)
Based on 1 Customer Validation
GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- Purity: 99.89%
- CAS No.: 223460-79-5
- 화학식: C165H254N44O55S
- 분자량:3766.19
-
보관:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Biological Activity
GLP-2 receptor[1]
GLP-2-treated group demonstrates a 518% increase in mucosal IGFBP-4 mRNA levels as compare with vehicle-treated controls. Because the mucosal expression of IGFBP-4 transcripts is found to be very low relative to that of the whole intestine, FRIC cultures are used as an in vitro model of the entire intestine. FRIC cultures have previously been established to express a functional GLP-2 receptor (GLP-2R) that displays a cAMP response, as well as enhances IGF-1 mRNA expression and IGF-1 secretion in response to GLP-2 treatment. When incubates with GLP-2 (10 8 M) for 2 hours, IGFBP-4 mRNA expression in the FRIC cultures is also found to be increased, by 40.8%, compare with vehicle-treated cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 223460-79-5
-
Appearance Solid
-
분자량 3766.19
-
화학식 C165H254N44O55S
-
Color White to off-white
-
Synonyms
GLP-2 (human); Glucagon-like peptide 2 (human)
-
Sequence
His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
-
Sequence Shortening
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
용액&용해도
DMSO : ≥ 100 mg/mL (26.55 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : 25 mg/mL (6.64 mM; ultrasonic and adjust pH to 9 with NH4OH)
H2O : 25 mg/mL (6.64 mM; ultrasonic and adjust pH to 9 with NH4OH)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Protocol
Fetal rat intestinal cells (FRICs) are collected by enzymatical digestion of whole fetal rat intestines (mixed sex) and cultured overnight in DMEM containing 4.5 g/L glucose, 5% fetal bovine serum, and 40 U/mL penicillin and 40 μg/mL streptomycin in 10 cm plates. Cells are then treated with GLP-2 (10−8 M) or vehicle in low-glucose DMEM with 0.5% FBS for 0.5 to 24 hours[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Hamsters that undergo intraduodenal catheterization (idc) are allowed 7 days of recovery before jugular vein catheterization. For postprandial experiments, conscious fasted (16 h) hamsters receive a 75 mmol/kg iv bolus of L-NAME. After 10 minutes, baseline blood sample is collected (time 0), followed by an oralgastric gavage of 3 μL Ci [9,10-3H(N)] triolein in 200 μL olive oil. At t=10 minutes, F-127 is given ip (1 g/kg) to inhibit peripheral TG-rich lipoprotein (TRL) catabolism. At t=20 minutes, the hamsters receive ip injections of either PBS or 0.25 mg/kg human GLP-2(1-33). Blood (400 μL) is collected every 30 minutes for 2 hours. Blood is centrifuged at 6000 rpm for 10 minutes at 4°C to isolate plasma. Radioactivity is assessed using a liquid scintillation counter[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
순도&문서
-
Data Sheet (273 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Kaori Austin, et al. IGF Binding Protein-4 is Required for the Growth Effects of Glucagon-Like Peptide-2 in Murine Intestine. Endocrinology. 2015 Feb; 156(2): 429-436. [Content Brief]
[2]. Hsieh J, et al. Glucagon-Like Peptide 2 (GLP-2) Stimulates Postprandial Chylomicron Production and Postabsorptive Release of Intestinal Triglyceride Storage Pools via Induction of Nitric Oxide Signaling in Male Hamsters and Mice. Endocrinology. 2015 Oct;156(10):3538-47. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O / H2O / DMSO | 1 mM | 0.2655 mL | 1.3276 mL | 2.6552 mL | 6.6380 mL |
| 5 mM | 0.0531 mL | 0.2655 mL | 0.5310 mL | 1.3276 mL | |
| DMSO | 10 mM | 0.0266 mL | 0.1328 mL | 0.2655 mL | 0.6638 mL |
| 15 mM | 0.0177 mL | 0.0885 mL | 0.1770 mL | 0.4425 mL | |
| 20 mM | 0.0133 mL | 0.0664 mL | 0.1328 mL | 0.3319 mL | |
| 25 mM | 0.0106 mL | 0.0531 mL | 0.1062 mL | 0.2655 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.