1. Peptides

PACAP (6-38), human, ovine, rat TFA 

Cat. No.: HY-P0220A Purity: 98.14%
Handling Instructions

PACAP (6-38), human, ovine, rat is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively. Sequence: Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2;FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

PACAP (6-38), human, ovine, rat TFA Chemical Structure

PACAP (6-38), human, ovine, rat TFA Chemical Structure

Size Price Stock Quantity
500 μg USD 120 In-stock
Estimated Time of Arrival: December 31
1 mg USD 160 In-stock
Estimated Time of Arrival: December 31
5 mg USD 480 In-stock
Estimated Time of Arrival: December 31
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Other Forms of PACAP (6-38), human, ovine, rat TFA:

  • Biological Activity

  • Protocol

  • Technical Information

  • Purity & Documentation

  • References


PACAP (6-38), human, ovine, rat is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively. Sequence: Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2;FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2.

IC50 & Target

IC50: 30 nM (PACAP type I receptor), 600 nM (PACAP type II receptor VIP1), 40 nM (PACAP type II receptor VIP2)[1]

In Vitro

An increase of dopamine (DA) content by HPLC analysis and/or cell proliferation identified by MTT assay by Dexamethasone (DEX) is also observed which can be inhibited by PACAP (6-38) at concentration sufficient to block PACAP type 1 (PAC1) receptor. Pretreatment with PAC1 receptor antagonist PACAP (6-38) at 0.1 or 1 μM for 2 h significantly blocks this increase of DA content by 1 μM DEX. The MTT assay shows that DEX increases cell proliferation. Moreover, this action is also inhibited by the pre-incubation of PACAP (6-38). PACAP (6-38) at 1μM shows no effect on DA content and cell proliferation for 24 h. However, PACAP (6-38) at 0.3 μM has been mentioned to reduce the spontaneous tyrosine hydroxylase (TH) accumulation in differentiated retinal cultured cells for 5 days[2].

In Vivo

Intravesical administration of the PAC1 receptor antagonist, PACAP (6-38), significantly increases intercontraction interval (2.0-fold) and void volume (2.5-fold) in NGF-OE mice. Intravesical instillation of PACAP (6-38) also decreases baseline bladder pressure in NGF-OE mice. Intravesical administration of PACAP (6-38) (300 nM) significantly (p≤0.01) reduces pelvic sensitivity in NGF-OE mice but is without effect in WT mice[3].

Solvent & Solubility
In Vitro: 

10 mM in DMSO

Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2416 mL 1.2081 mL 2.4162 mL
5 mM 0.0483 mL 0.2416 mL 0.4832 mL
10 mM 0.0242 mL 0.1208 mL 0.2416 mL
*Please refer to the solubility information to select the appropriate solvent.
Cell Assay

PC12 cells (5×104 cells per well) are deposited in a 96-well flat-bottom culture plate. Cells are incubated with PACAP(6-38) (0.1 and 1.0 μM) for 2 h before the addition of Dexamethasone (DEX, 1 μM). Cells are harvested at 24 h later of treatment. At regular intervals after the additional treatments, 100 μL of 0.2 mg/mL MTT is added per each well, and cells are incubated for 3 h at 37°C. After incubation, the MTT reagent is discarded and 100 μL of DMSO is then added. The experiment is performed at room temperature for 20 min [2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Administration

Two groups of mice are evaluated: WT mice receiving intravesical administration of vehicle (0.9% saline) and PACAP (6-38) (300 nM) (n=8) and NGF-OE mice receiving intravesical administration of vehicle (0.9% saline) and PACAP (6-38) (300 nM) (n=8). For intravesical administration of PACAP (6-38), mice are anesthetized with 2% isoflurane and PACAP (6-38) (<1.0 mL) is injected through the bladder catheter; the animals are maintained under anesthesia to prevent expulsion of PACAP (6-38) via a voiding reflex. In this procedure, PACAP (6-38) remains in the bladder for 30 min at which time, the drug is drained, the bladder washed with saline and animals recover from anesthesia for 20 min before experimentation[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight




Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name



Applicant name *


Email address *

Phone number *


Organization name *

Country or Region *


Requested quantity *


Bulk Inquiry

Inquiry Information

Product Name:
PACAP (6-38), human, ovine, rat TFA
Cat. No.:

PACAP (6-38), human, ovine, rat TFA

Cat. No.: HY-P0220A