1. Peptides

Prolactin Releasing Peptide (1-31), human 

Cat. No.: HY-P1520
Handling Instructions

Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin. Human and rat Prolactin Releasing Peptide (1-31) binds to GPR10 with Kis of 1.03 and 0.33 nM, respectively.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Prolactin Releasing Peptide (1-31), human Chemical Structure

Prolactin Releasing Peptide (1-31), human Chemical Structure

Size Price Stock
500 μg USD 220 Get quote
1 mg USD 360 Get quote
5 mg USD 1100 Get quote

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Protocol

  • Technical Information

  • Purity & Documentation

  • References

Description

Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin. Human and rat Prolactin Releasing Peptide (1-31) binds to GPR10 with Kis of 1.03 and 0.33 nM, respectively.

IC50 & Target

Ki: 1.03±0.41 nM (GPR10, human PrRP 1-31), 0.33±0.11 nM (GPR10, rat PrRP 1-31) [1]

In Vitro

Prolactin Releasing Peptide (PrRP) has been identified as a specific, high affinity endogenous ligand for GPR10. Prolactin Releasing Peptide (PrRP) preproprotein can be cleaved at two different positions to give rise to two forms of 31 or 20 amino acids; Prolactin Releasing Peptide (PrRP)-31 and Prolactin Releasing Peptide (PrRP)-20 respectively. Rat Prolactin Releasing Peptide (PrRP) has also been identified and occurs as 31 or 20 amino acid forms; these peptides are highly conserved between species. Human PrRP-20, human PrRP-31, rat PrRP-20 and rat PrRP-31 display high affinity for GPR10 receptors, with Ki values of 0.26±0.07, 1.03±0.41, 0.22±0.06 and 0.33±0.11 nM, respectively[1].

In Vivo

Following intracerebroventricular injection of Prolactin Releasing Peptide (1-31), human 5 nM there is a highly significant simulation of plasma LH that began at 10 minutes and is maintained over the course of the experiment. Plasma FSH increased at 20 minutes following ICV injection. Total plasma testosterone increased at 60 minutes post injection[2].

Solvent & Solubility
In Vitro: 

H2O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
References
Animal Administration
[1]

Rats[1]

Groups of rats are injected with either Prolactin Releasing Peptide (1-31) 5 nM or saline. Prolactin Releasing Peptide (1-31), human is dissolved in saline is administered in a total volume of 10 μL. Animals are habituated to the injection procedures by three ICV injections prior to the study to minimize stress in the animals. At 10, 20, 60 minutes following injection, rats are decapitated and trunk blood collected into plastic tubes[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References
Molecular Weight

3664.15

Formula

C₁₆₀H₂₅₂N₅₆O₄₂S

Sequence

Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2

Sequence Shortening

SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Prolactin Releasing Peptide (1-31), human
Cat. No.:
HY-P1520
Quantity:

Prolactin Releasing Peptide (1-31), human

Cat. No.: HY-P1520