2. GPCR/G Protein Neuronal Signaling
  3. CGRP Receptor
  4. Cagrilintide acetate

Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Synthèse de peptides personnalisée

Cagrilintide acetate

Cagrilintide acetate Chemical Structure

Size Prix Stock Quantité
1 mg En stock
5 mg En stock
10 mg En stock
50 mg   Obtenir un devis  
100 mg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

This product is a controlled substance and not for sale in your territory.

Avis client

Based on 3 publication(s) in Google Scholar

Other Forms of Cagrilintide acetate:

Cagrilintide acetate Related Antibodies

Top Publications Citing Use of Products

3 Publications Citing Use of MCE Cagrilintide acetate

  • Activité biologique

  • Pureté et documentation

  • Références

  • Avis client

Description

Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies[1][2][3].

IC50 & Target

AMYR, CTR[1][2][3].
In Vivo

Cagrilintide acetate (compound 23) (0.1, 1, 3, 10, 30 nmol/kg; s.c.single) reduces food intake in the rat[1].
Cagrilintide acetate (10 nmol/kg; i.v. or s.c.; single) shows good pharmacokinetic parameters[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Sprague Dawley male rats (12-week-old; ~400 g)[1]
Dosage: 0.1, 1, 3, 10, 30 nmol/kg
Administration: Subcutaneous injection; single
Result: Reduced food intake in the rat for several days at doses in the range of 1-10 nmol/kg.
Animal Model: Sprague Dawley male rats (12-week-old; ~400 g)[1]
Dosage: 10 nmol/kg
Administration: Intravenous injection or subcutaneous injection; single
Result: Showed good pharmacokinetic parameters with T1/2 of 20, 27 h for i.v. and s.c., respectively.
Masse moléculaire

4409.01 (free base)

Formule

C194H312N54O59S2.xC2H4O2
Appearance

Solid

Color

White to off-white

Sequence

{Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8)
Sequence Shortening

{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)
Livraison

Room temperature in continental US; may vary elsewhere.
Stockage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvant et solubilité
In Vitro: 

DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H2O : 50 mg/mL (Need ultrasonic)

  • Calculateur de molarité

  • Calculateur de dilution

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Pureté et documentation

Purity: 99.96%

SDS (252 KB)

COA (272 KB) RP-HPLC (252 KB) MS (74 KB)

Instruction de manipulation (2659 KB)
Références
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Cagrilintide acetate Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

CagrilintideCGRP ReceptorCalcitonin gene-related peptide receptorobesityweight lossfood intakeInhibitorinhibitorinhibit

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

Nom du produit

  

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

      

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
Cagrilintide acetate
Cat. No.:
HY-P3462A
Quantité:
MCE Japan Authorized Agent:

Avis client

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Nom du produit

  

Lot #

Nom du demandeur *

 

Adresse e-mail *

Numéro de téléphone

 

Department *

Nom de l'organisation *

 

Country or Region *

Remarques

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.