1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins Enzymes & Regulators
  3. FGF Family Stem Cell CD Proteins Epithelial cell CD Proteins Receptor Tyrosine Kinases Cytokine Receptors Protein Tyrosine Kinases
  4. FGFR
  5. FGFR-3
  6. FGFR-3 alpha (IIIc) Protein, Human (HEK293, Fc)

FGFR-3 alpha (IIIc) Protein, Human (HEK293, Fc)

Cat. No.: HY-P70817
Handling Instructions Technical Support

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 alpha (IIIc) Protein, Human (HEK293, Fc) is the recombinant human-derived FGFR-3 protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
2 μg 견적 받기
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE FGFR-3 alpha (IIIc) Protein, Human (HEK293, Fc)

  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 alpha (IIIc) Protein, Human (HEK293, Fc) is the recombinant human-derived FGFR-3 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

FGFR-3 protein, a tyrosine-protein kinase, functions as a cell-surface receptor for fibroblast growth factors, playing a vital role in the regulation of cell proliferation, differentiation, and apoptosis. Its significance is particularly notable in the regulation of chondrocyte differentiation, proliferation, and apoptosis, contributing to normal skeleton development. Additionally, FGFR-3 plays a crucial role in both osteogenesis and postnatal bone mineralization by osteoblasts, while also promoting apoptosis in chondrocytes. Beyond its role in normal development, FGFR-3 is involved in inner ear development and has implications in the regulation of vitamin D metabolism. Upon ligand binding, FGFR-3 activates several signaling cascades, including the phosphorylation of PLCG1, CBL, and FRS2. This activation leads to the production of cellular signaling molecules such as diacylglycerol and inositol 1,4,5-trisphosphate. Furthermore, phosphorylation of FRS2 triggers the recruitment of GRB2, GAB1, PIK3R1, and SOS1, mediating the activation of RAS, MAPK1/ERK2, MAPK3/ERK1, the MAP kinase signaling pathway, and the AKT1 signaling pathway. Mutations leading to constitutive kinase activation or impairing normal FGFR3 maturation, internalization, and degradation result in aberrant signaling. Overexpression or constitutive activation of FGFR3 promotes the activation of PTPN11/SHP2, STAT1, STAT5A, and STAT5B. Additionally, the secreted isoform 3 retains its capacity to bind FGF1 and FGF2, potentially interfering with FGF signaling.

Biological Activity

1.This product does not contain protein kinase domain.
2.Measured by its ability to inhibit FGF acidic-dependent proliferation of NIH-3T3 mouse fibroblast cells. The ED50 for this effect is 2.53-10.64 ng/mL, corresponding to a specific activity is 9.398×104- 3.95×105 U/mg.
3.The ED50 as determined by its ability to inhibit FGF acidic-dependent proliferation of BALB/c 3T3 cells is less than 100 ng/mL.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P22607-1 (E23-G375)

Gene ID
Molecular Construction
N-term
FGFR-3 (E23-G375)
Accession # P22607-1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Fibroblast growth factor receptor 3; FGFR-3; CD333; FGFR3; JTK4; IIIc
AA Sequence

ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG

분자량

95-110 kDa

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

FGFR-3 alpha (IIIc) Protein, Human (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
FGFR-3 alpha (IIIc) Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70817
수량:
MCE Japan Authorized Agent: