IL-11 Protein, Human (CHO)

IL-11 Protein, Human (CHO) is a CHO cell derived protective factor, which has a protective role and can accelerate recovery of platelets, and remarkably lessen the extent of inflammatory responses.

Recombinant Human Interleukin-11 (IL-11) plays a very crucial role in inflammation. Being an essential cytokine, IL-11 promotes chronic gastric inflammation and also associated with STAT3 and STAT1 mediated tumorigenesis. In addition, IL-11 is also an indispensable factor in IL-13- induced Th2-mediated inflammatory disorders and tissue remodeling. IL-11 has diverse biological functions. It has a protective role against neutron radiation injury, capable of promoting a faster recovery of small intestine injuries and also functions in response to inflammation in animal models of infection. Studies have revealed that IL-11 protects animal models of sepsis from liver injuries. Although its role in platelet production in neonates remains unclear, IL-11 is reported to be involved in the endogenous cytokine response to sepsis or Necrotizing Enterocolitis (NEC) in premmies. IL-11 is also involved in NF-κB signaling pathway and inhibition of IL-6 can reduce colitis associated tumorigenesis ^[1]. Recombinant human interleukin-11 directly promotes megakaryocytopoiesis in vitro^[2].

The ED₅₀ is <5 ng/mL as measured in a proliferation assay by TF-1 cells.

Human

CHO

Tag Free

P20809-1 (P22-L199)

3589  [NCBI]

Full Length of Isoform-1 Mature Protein

PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Approximately 23 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/sup-b15-cell.html  [Content Brief]

  [2]. Wan B, et al. Recombinant human interleukin-11 (IL-11) is a protective factor in severe sepsis with thrombocytopenia: A case-control study. Cytokine. 2015 Dec;76(2):138-143.  [Content Brief]

  [3]. Weich NS, et al. Recombinant human interleukin-11 directly promotes megakaryocytopoiesis in vitro. Blood. 1997 Nov 15;90(10):3893-902.  [Content Brief]