IL-13 Protein, Mouse

IL-13 Protein, Mouse is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8^[1].

IL-13 is a potent down-modulator of macrophage proinflammatory activity in vitro, similar in this context to the anti-inflammatory cytokines IL-4 and IL-10^[1].

The cell proliferation assay using TF-1 human erythroleukemic cells has an ED₅₀ value of ≤1.6 ng/mL.

Mouse

E. coli

Tag Free

P20109 (S26-F131)

16163  [NCBI]

SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Approximately 10.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Histidine-HCl, 8% Trehalose, 4% Mannitol, 50 mM NaCl, 0.05% Tween 80, pH 6.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. T Muchamuel, et al. IL-13 protects mice from lipopolysaccharide-induced lethal endotoxemia: correlation with down-modulation of TNF-alpha, IFN-gamma, and IL-12 production. J Immunol. 1997 Mar 15;158(6):2898-903.  [Content Brief]