L-selectin/CD62L Protein, Human (HEK293, His)

L-Selectin, also known as CD62L, is a calcium-dependent lectin that plays a crucial role in mediating cell adhesion by binding to glycoproteins on neighboring cells. Functionally, it facilitates the adherence of lymphocytes to endothelial cells within high endothelial venules in peripheral lymph nodes, promoting the initial tethering and rolling of leukocytes in endothelial tissues. L-Selectin's interaction with SELPLG/PSGL1 and PODXL2 is vital for the recruitment and rolling of leukocytes. This interaction is specifically dependent on the sialyl Lewis X glycan modification of SELPLG and PODXL2, along with tyrosine sulfation modifications of SELPLG. Notably, sulfation on 'Tyr-51' of SELPLG emerges as a critical factor for effective L-Selectin binding. The multifaceted functions of L-Selectin underscore its significance in orchestrating cell adhesion processes and immune cell recruitment. L-selectin/CD62L Protein, Human (HEK293, His) is the recombinant human-derived L-selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag. The total length of L-selectin/CD62L Protein, Human (HEK293, His) is 294 a.a., with molecular weight of 50-75 kDa.

L-Selectin, also known as CD62L, is a calcium-dependent lectin that plays a crucial role in mediating cell adhesion by binding to glycoproteins on neighboring cells. Functionally, it facilitates the adherence of lymphocytes to endothelial cells within high endothelial venules in peripheral lymph nodes, promoting the initial tethering and rolling of leukocytes in endothelial tissues. L-Selectin's interaction with SELPLG/PSGL1 and PODXL2 is vital for the recruitment and rolling of leukocytes. This interaction is specifically dependent on the sialyl Lewis X glycan modification of SELPLG and PODXL2, along with tyrosine sulfation modifications of SELPLG. Notably, sulfation on 'Tyr-51' of SELPLG emerges as a critical factor for effective L-Selectin binding. The multifaceted functions of L-Selectin underscore its significance in orchestrating cell adhesion processes and immune cell recruitment.

Measured by the ability of the immobilized protein to support the adhesion of THP-1 human prostate cancer cells. The ED₅₀ for this effect is 2.231 μg/mL, corresponding to a specific activity is 448.230 units/mg.

• 
  Measured by the ability of the immobilized protein to support the adhesion of THP-1 human prostate cancer cells.  The ED₅₀ for this effect is 2.231 μg/mL, corresponding to a specific activity is 448.230 units/mg.

Human

HEK293

C-His

P14151 (W39-N332)

6402  [NCBI]

WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN

50-75 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.