L-Selectin/CD62L Protein, Rat (HEK293, His)
Based on 1 Customer Validation
L-selectin/CD62L is a calcium-dependent lectin that binds adjacent glycoproteins to allow lymphocyte adhesion to endothelial cells in peripheral lymph nodes. This encourages leukocytes to bind and roll within endothelial tissue. L-Selectin/CD62L Protein, Rat (HEK293, His) is the recombinant rat-derived L-Selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
L-selectin/CD62L is a calcium-dependent lectin that binds adjacent glycoproteins to allow lymphocyte adhesion to endothelial cells in peripheral lymph nodes. This encourages leukocytes to bind and roll within endothelial tissue. L-Selectin/CD62L Protein, Rat (HEK293, His) is the recombinant rat-derived L-Selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.
Background
L-Selectin/CD62L, a calcium-dependent lectin, plays a pivotal role in cell adhesion by binding to glycoproteins on adjacent cells. It facilitates the adherence of lymphocytes to the endothelial cells of high endothelial venules in peripheral lymph nodes, promoting the initial tethering and rolling of leukocytes within endothelial tissues. The recruitment and rolling of leukocytes are dependent on interactions with SELPLG/PSGL1 and PODXL2, where the sialyl Lewis X glycan modification of SELPLG and PODXL2, along with tyrosine sulfation modifications of SELPLG, are essential. Notably, the sulfation on 'Tyr-51' of SELPLG emerges as a critical factor for the binding of L-Selectin, underscoring its importance in facilitating cellular interactions and adhesive processes.
Verified Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5×104 cells/well are added to Rat L-Selectin coated plates (10 μg/mL, 100 μL/well), will induce 52.78% adhesion on U937 cells after 1 hour at 37°C.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
P30836 (W39-N332)
-
Molecular Construction
-
N-term
-
L-selectin (W39-N332)
Accession # P30836 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SELL; Lymphocyte Adhesion Molecule 1; Prev. LYAM1; Gp90-MEL; Prev. LNHR; Lyam-1; L-Selectin; LECAM1; LAM-1; HLHRc; PLNHR; Leu-8; CD62L; TQ1; LSEL; Leukocyte Adhesion Molecule 1; LAM1; Pln Homing Receptor; Leukocyte-Endothelial Cell Adhesion Molecule 1; CD
-
AA Sequence
WTYHYSERSMNWENARKFCKHNYTDLVAIQNKREIEYLEKTLPKNPTYYWIGIRKIGKTWTWVGTNKTLTKEAENWGTGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPESCNRHGECVETINNNTCICDPGYYGPQCQYVIQCEPLKAPELGTMNCIHPLGDFSFQSQCAFNCSEGSELLGNAKTECGASGNWTYLEPICQVIQCMPLAAPDLGTMECSHPLANFSFTSACTFTCSEETDLIGERKTVCRSSGSWSSPSPICQKTKRSFSKIKEGDYN
-
Molecular Weight
Approximately 43-55 kDa due to the glycosylation
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
