Copy Link Print Information

L-selectin/CD62L Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

L-selectin, a calcium-dependent lectin, binds to glycoproteins on adjacent cells, facilitating lymphocyte attachment to endothelial cells in peripheral lymph nodes. This interaction is essential for leukocyte rolling along the endothelium and requires L-selectin's binding to SELPLG/PSGL1 and PODXL2, dependent on glycan and sulfation modifications. Sulfation of 'Tyr-51' on SELPLG is particularly important for L-selectin binding. L-selectin/CD62L Protein, Mouse (HEK293, His) is the recombinant mouse-derived L-selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for L-selectin/CD62L Protein, Mouse (HEK293, His)
  • L-selectin/CD62L Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

L-selectin, a calcium-dependent lectin, binds to glycoproteins on adjacent cells, facilitating lymphocyte attachment to endothelial cells in peripheral lymph nodes. This interaction is essential for leukocyte rolling along the endothelium and requires L-selectin's binding to SELPLG/PSGL1 and PODXL2, dependent on glycan and sulfation modifications. Sulfation of 'Tyr-51' on SELPLG is particularly important for L-selectin binding. L-selectin/CD62L Protein, Mouse (HEK293, His) is the recombinant mouse-derived L-selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.

Background

L-selectin, a calcium-dependent lectin, plays a crucial role in cell adhesion through its binding to glycoproteins on adjacent cells. Specifically, it facilitates the attachment of lymphocytes to endothelial cells in high endothelial venules within peripheral lymph nodes, promoting the initial tethering and rolling of leukocytes along the endothelium. This process requires the interaction of L-selectin with SELPLG/PSGL1 and PODXL2, which is dependent on the sialyl Lewis X glycan modification of SELPLG and PODXL2, as well as the tyrosine sulfation modifications of SELPLG. Notably, the sulfation of 'Tyr-51' on SELPLG is of particular importance for the binding of L-selectin.

Verified Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of LS180 human colorectal adenocarcinoma cells. The ED50 for this effect is 5.230 μg/mL, corresponding to a specific activity is 191.205 units/mg.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by the ability of the immobilized protein to support the adhesion of LS180 human colorectal adenocarcinoma cells. The ED50 for this effect is 5.230 μg/mL, corresponding to a specific activity is 191.205 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    NP_035476.1 (W39-N332)

  • Gene ID
    20343  [NCBI]
  • Molecular Construction
    • N-term
    • L-selectin/CD62L (D29-N332)
      Accession # NP_035476.1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SELL; Lymphocyte Adhesion Molecule 1; Prev. LYAM1; Gp90-MEL; Prev. LNHR; Lyam-1; L-Selectin; LECAM1; LAM-1; HLHRc; PLNHR; Leu-8; CD62L; TQ1; LSEL; Leukocyte Adhesion Molecule 1; LAM1; Pln Homing Receptor; Leukocyte-Endothelial Cell Adhesion Molecule 1; CD

  • AA Sequence

    WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYN

  • Predicted Molecular Mass

    34.7 kDa

  • Molecular Weight

    Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured by the ability of the immobilized protein to support the adhesion of LS180 human colorectal adenocarcinoma cells. The ED50 for this effect is 5.230 μg/mL, corresponding to a specific activity is 191.205 units/mg.

  • L-selectin/CD62L Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for L-selectin/CD62L Protein, Mouse (HEK293, His)
  • L-selectin/CD62L Protein, Mouse (HEK293, His) Product Image