L-selectin/CD62L Protein, Mouse (HEK293, His)

L-selectin, a calcium-dependent lectin, binds to glycoproteins on adjacent cells, facilitating lymphocyte attachment to endothelial cells in peripheral lymph nodes. This interaction is essential for leukocyte rolling along the endothelium and requires L-selectin's binding to SELPLG/PSGL1 and PODXL2, dependent on glycan and sulfation modifications. Sulfation of 'Tyr-51' on SELPLG is particularly important for L-selectin binding. L-selectin/CD62L Protein, Mouse (HEK293, His) is the recombinant mouse-derived L-selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.

L-selectin, a calcium-dependent lectin, plays a crucial role in cell adhesion through its binding to glycoproteins on adjacent cells. Specifically, it facilitates the attachment of lymphocytes to endothelial cells in high endothelial venules within peripheral lymph nodes, promoting the initial tethering and rolling of leukocytes along the endothelium. This process requires the interaction of L-selectin with SELPLG/PSGL1 and PODXL2, which is dependent on the sialyl Lewis X glycan modification of SELPLG and PODXL2, as well as the tyrosine sulfation modifications of SELPLG. Notably, the sulfation of 'Tyr-51' on SELPLG is of particular importance for the binding of L-selectin.

Measured by the ability of the immobilized protein to support the adhesion of LS180 human colorectal adenocarcinoma cells. The ED₅₀ for this effect is 5.230 μg/mL, corresponding to a specific activity is 191.205 units/mg.

• 
  Measured by the ability of the immobilized protein to support the adhesion of LS180 human colorectal adenocarcinoma cells. The ED₅₀ for this effect is 5.230 μg/mL, corresponding to a specific activity is 191.205 units/mg.

Mouse

HEK293

C-His

NP_035476.1 (W39-N332)

20343  [NCBI]

Partial

WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYN

70-80 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.