Dendrotoxin-I (Synonyms: DTX-I)

Cat. No.: HY-P3055: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Dendrotoxin-I is a potent K⁺ channels blocker and targets voltage-gated potassium channel subunits KV1.1 and KV1.2. Dendrotoxin-I is a neurotoxin isolated from thevenom of Dendroaspis snakes.

For research use only. We do not sell to patients.

Dendrotoxin-I Chemical Structure

CAS No. : 107950-33-4

Size		Stock
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

Dendrotoxin-I is a potent K⁺ channels blocker and targets voltage-gated potassium channel subunits KV1.1 and KV1.2. Dendrotoxin-I is a neurotoxin isolated from thevenom of Dendroaspis snakes^[1]^[2]^[3].

In Vivo

Dendrotoxin-I (5 mg/kg; IV) displays a significant tumor growth inhibition effect combined with hyperthermia^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	Nude mice with MCF-7 cells^[3]
Dosage:	5 mg/kg
Administration:	IV
Result:	Displayed a significanttumor growth inhibition effect combined with hyperthermia. Could not keep on inhibiting the growth of tumor at the later period of treatment.

Molecular Weight

7149.24

Formula

C₃₁₂H₄₉₁N₉₉O₈₃S₆

CAS No.

107950-33-4

Sequence

Gln-Pro-Leu-Arg-Lys-Leu-Cys-Ile-Leu-His-Arg-Asn-Pro-Gly-Arg-Cys-Tyr-Gln-Lys-Ile-Pro-Ala-Phe-Tyr-Tyr-Asn-Gln-Lys-Lys-Lys-Gln-Cys-Glu-Gly-Phe-Thr-Trp-Ser-Gly-Cys-Gly-Gly-Asn-Ser-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Ile-Arg-Lys (Disulfide bridge:Cys7-Cys57;Cys16-Cys40;Cys32-Cys53)

Sequence Shortening

QPLRKLCILHRNPGRCYQKIPAFYYNQKKKQCEGFTWSGCGGNSNRFKTIEECRRTCIRK (Disulfide bridge:Cys7-Cys57;Cys16-Cys40;Cys32-Cys53)

Structure Classification

Cyclopeptides

Initial Source

Dendroaspis polylepis and angusticeps

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Handling Instructions (2659 KB)

References

[1]. H Rehm, et al. Purification and subunit structure of a putative K+-channel protein identified by its binding properties for dendrotoxin I. Proc Natl Acad Sci U S A. 1988 Jul;85(13):4919-23. [Content Brief]

[2]. Tess Wright, et al. Firing frequency and entrainment maintained in primary auditory neurons in the presence of combined BDNF and NT3. Sci Rep. 2016 Jun 23;6:28584. [Content Brief]

[3]. Hui Zhang, et al. Preparation, characterization, and pharmacodynamics of thermosensitive liposomes containing docetaxel. J Pharm Sci. 2014 Jul;103(7):2177-2183. [Content Brief]

Dendrotoxin-I Related Classifications

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Dendrotoxin-I107950-33-4DTX-IPotassium ChannelKcsAInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks