2. Apoptosis
  3. MDM-2/p53 Apoptosis
  4. FOXO4-DRI

FOXO4-DRI is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI is a senolytic peptide that induces apoptosis of senescent cells.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Synthèse de peptides personnalisée

FOXO4-DRI

FOXO4-DRI Chemical Structure

CAS No. : 2460055-10-9

Size Prix Stock Quantité
1 mg En stock
5 mg En stock
10 mg En stock
50 mg   Obtenir un devis  
100 mg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

This product is a controlled substance and not for sale in your territory.

Avis client

Based on 1 Customer Validation

Other Forms of FOXO4-DRI:

FOXO4-DRI Related Antibodies

Top Publications Citing Use of Products

  • Activité biologique

  • Pureté et documentation

  • Références

  • Avis client

Description

FOXO4-DRI is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI is a senolytic peptide that induces apoptosis of senescent cells[1].

In Vitro

FOXO4-DRI (25 mM; 3 days) causes nuclear exclusion of active p53 and induces apoptosis in senescent TM3 Leydig cells[1].
FOXO4-DRI (25 μM; 5 days) significantly reduces the senescence level in PDL9 cells[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

FOXO4-DRI Related Antibodies

Cell Viability Assay[1]

Cell Line: Senescent Leydig cells
Concentration: 25 mM
Incubation Time: 3 days
Result: Reduced the viability of senescent as compared to normal TM3 Leydig cells.

Apoptosis Analysis[1]

Cell Line: Senescent Leydig cells
Concentration: 25 mM
Incubation Time: 3 days
Result: The apoptosis rate increased from 10% to 27%.

Western Blot Analysis[2]

Cell Line: PDL9 cells
Concentration: 25 μM
Incubation Time: 5 days
Result: Decreased the protein levels of representative senescent markers, including p16, p21, and p53.

RT-PCR[2]

Cell Line: PDL9 cells
Concentration: 25 μM
Incubation Time: 5 days
Result: Enhanced SOX9 expression, and reduced MMP12 and MMP13 expression.
In Vivo

FOXO4-DRI (5 mg/kg; i.p.; every other day for three administrations) alleviates testosterone secretion insufficiency and improves the testicular microenvironment in naturally aged mice[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Naturally aged male C57BL/6 mice (20-24 months old)[1]
Dosage: 5 mg/kg
Administration: Intraperitoneal injection, every other day for three administrations
Result: Increased serum testosterone levels. Increased levels of both 3β-HSD and CYP11A1. Decreased interstitial SA-β-gal activity and lowered levels of senescence-associated proteins p53, p21, and p16. Decreased the levels of IL-1β, IL-6 and TGF-β.
Masse moléculaire

5358.06

Formule

C228H388N86O64
CAS No.
Appearance

Solid

Color

White to off-white

Sequence

D-(Leu-Thr-Leu-Arg-Lys-Glu-Pro-Ala-Ser-Glu-Ile-Ala-Gln-Ser-Ile-Leu-Glu-Ala-Tyr-Ser-Gln-Asn-Gly-Trp-Ala-Asn-Arg-Arg-Ser-Gly-Gly-Lys-Arg-Pro-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly)
Sequence Shortening

D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)
Livraison

Room temperature in continental US; may vary elsewhere.
Stockage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvant et solubilité
In Vitro: 

H2O : 100 mg/mL (18.66 mM; Need ultrasonic)

DMSO : 50 mg/mL (9.33 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.1866 mL 0.9332 mL 1.8663 mL
5 mM 0.0373 mL 0.1866 mL 0.3733 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Calculateur de molarité

  • Calculateur de dilution

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Pureté et documentation

Purity: 99.96%

SDS (252 KB)

COA (269 KB) RP-HPLC (264 KB) MS (75 KB) Elemental Analysis Report (128 KB)

Instruction de manipulation (2659 KB)
Références

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO / H2O 1 mM 0.1866 mL 0.9332 mL 1.8663 mL 4.6659 mL
5 mM 0.0373 mL 0.1866 mL 0.3733 mL 0.9332 mL
H2O 10 mM 0.0187 mL 0.0933 mL 0.1866 mL 0.4666 mL
15 mM 0.0124 mL 0.0622 mL 0.1244 mL 0.3111 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

FOXO4-DRI Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

FOXO4-DRI2460055-10-9MDM-2/p53Apoptosismale late-onset hypogonadismsenolyticsTM3 Leydig cellsPDL9FOXO4Inhibitorinhibitorinhibit

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

Nom du produit

  

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

      

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
FOXO4-DRI
Cat. No.:
HY-P4157
Quantité:
MCE Japan Authorized Agent:

Avis client

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Nom du produit

  

Lot #

Nom du demandeur *

 

Adresse e-mail *

Numéro de téléphone

 

Department *

Nom de l'organisation *

 

Country or Region *

Remarques

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.