2. Peptides
  3. GIP, rat

GIP, rat is a biological active peptide. (GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.)

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GIP, rat Chemical Structure

GIP, rat Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of GIP, rat:

Other Forms of GIP, rat:

GIP, rat Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • Customer Review

Description

GIP, rat is a biological active peptide. (GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.)

Molecular Weight

5002.58

Formula

C226H343N61O66S
Sequence

Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Leu-Thr-Gln
Sequence Shortening

YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

GIP, ratOthersInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GIP, rat
Cat. No.:
HY-P5390
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.