GIP, rat TFA
Based on 1 Customer Validation
GIP, rat TFA is a bioactive peptide derived from rats. GIP, rat TFA inhibits GIP-mediated postprandial insulin release as well as GIP-promoted glucose uptake in the upper small intestine. GIP, rat TFA can be used in research related to insulin resistance, glucose intolerance, and type 2 diabetes.
For research use only. We do not sell to patients.
- Purity: 99.81%
- Formula: C226H343N61O66S.xC2HF3O2
- Molecular Weight:5002.58 (free base)
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Biological Activity
Description
In Vitro
GIP, rat TFA (4 h) stimulates cAMP-dependent β-galactosidase production in LGIPR2 cells, with maximum activity observed at a concentration of 10-8 M following 4 h of incubation[5].
GIP, rat TFA binds to GIP receptors on stably transfected L293 cells with an IC50 of 7 nM[5].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Wistar (male, 250-350 g, fasted for 20 h prior to experimentation, anesthetized with sodium pentobarbital)[3]
-
Dosage:0.9 μg immunoreactive rat GIP·kg-1·h-1
-
Administration:i.v.; continuous infusion; 90 minutes
-
Result:Nearly doubled glucose-induced insulin release, with plasma insulin reaching 178 mU/l at 30 minutes and 171 mU/l at 90 minutes.
Trebled integrated 90-minute insulin response (13.67 mU/mL vs. 4.52 mU/mL for glucose alone).
Significantly reduced integrated 90-minute glucose response (0.28 mol/l vs. 0.53 mol/l for glucose alone).
Raised peak plasma immunoreactive GIP from a basal level of 239 pg/mL to 983 pg/mL at 30 minutes.
Chemical Information
-
Appearance Solid
-
Molecular Weight 5002.58 (free base)
-
Formula C226H343N61O66S.xC2HF3O2
-
Color White to off-white
-
Sequence
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Leu-Thr-Gln
-
Sequence Shortening
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Solvent & Solubility
In Vitro:
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Purity & Documentation
-
Data Sheet (271 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Tseng CC, et al. Effect of GIP and GLP-1 antagonists on insulin release in the rat. The American journal of physiology. 1999 Jun;276(6):E1049-54. [Content Brief]
[2]. Wewer Albrechtsen NJ, et al. The intestinal distribution pattern of appetite- and glucose regulatory peptides in mice, rats and pigs. BMC research notes. 2016 Feb 02;9:60. [Content Brief]
[3]. Ebert R, et al. Preservation of incretin activity after removal of gastric inhibitory polypeptide (GIP) from rat gut extracts by immunoadsorption. Diabetologia. 1983 Jun;24(6):449-54. [Content Brief]
[4]. Gniuli D, et al. High-fat feeding stimulates endocrine, glucose-dependent insulinotropic polypeptide (GIP)-expressing cell hyperplasia in the duodenum of Wistar rats. Diabetologia. 2010 Oct;53(10):2233-40. [Content Brief]
[5]. Tseng CC, et al. Postprandial stimulation of insulin release by glucose-dependent insulinotropic polypeptide (GIP). Effect of a specific glucose-dependent insulinotropic polypeptide receptor antagonist in the rat. J Clin Invest. 1996 Dec 1;98(11):2440-5. [Content Brief]
[6]. Widenmaier SB, et al. A GIP receptor agonist exhibits beta-cell anti-apoptotic actions in rat models of diabetes resulting in improved beta-cell function and glycemic control. PloS one. 2010 Mar 09;5(3):e9590. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)