GLP-1 (1-36) amide (human, rat) TFA
Based on 1 Customer Validation
GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat) ) TFA is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) TFA can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells.
For research use only. We do not sell to patients.
- Purity: 98.02%
- Formula: C184H273N51O57.xC2HF3O2
- Molecular Weight:4111.44 (free base)
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Biological Activity
Chemical Information
-
Appearance Solid
-
Molecular Weight 4111.44 (free base)
-
Formula C184H273N51O57.xC2HF3O2
-
Color White to off-white
-
Synonyms
Glucagon-like Peptide 1 (1-36) amide (human, rat) TFA
-
Sequence
His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
-
Sequence Shortening
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Solvent & Solubility
H2O : 16.67 mg/mL (Need ultrasonic)
Purity & Documentation
-
Data Sheet (282 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)