GIP (mouse)
Based on 1 Customer Validation
GIP (Gastric inhibitory polypeptide) (mouse) is a gastrointestinal hormone that is secreted by the intestinal K cells, and also expressed in and secreted from pancreatic islets. GIP (mouse) promotes insulin secretion from pancreatic β cells via the G-protein-coupled GIP receptor (GIPR). GIP (mouse) promotes pancreatic β cell proliferation and inhibits apoptosis. GIP (mouse) also exerts direct lipogenic effects on adipose tissue.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 98.79%
- CAS. Nr.: 181591-59-3
- Formel: C225H342N62O66S
- Molecular Weight:5003.56
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
-
Lösungsmittel & Löslichkeit
- Reinheit & Dokumentation
- Verweise
-
Help & FAQs
Biologische Aktivität
GIP (mouse) promotes β cell proliferation and inhibits apoptosis, thereby expanding pancreatic β cell mass[2].
GIP (mouse) (0-10-8 M, 3 h) stimulates significant increases in heparin-releasable lipoprotein lipase (LPL) activity in 3T3-L1 adipocytes in a dose-dependent manner[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS. Nr. 181591-59-3
-
Appearance Solid
-
Molecular Weight 5003.56
-
Formel C225H342N62O66S
-
Color White to off-white
-
Synonyms
Gastric inhibitory polypeptide(mouse); GIP(1-42) (mouse)
-
Sequence
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Arg-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
-
Sequence Shortening
YAEGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Lösungsmittel & Löslichkeit
H2O : ≥ 100 mg/mL (19.99 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Reinheit & Dokumentation
-
Data Sheet (286 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Yukihiro Fujita, et al. Glucose-dependent insulinotropic polypeptide is expressed in pancreatic islet alpha-cells and promotes insulin secretion. Gastroenterology. 2010 May;138(5):1966-75. [Content Brief]
[2]. Seino Y, et al. GIP and GLP-1, the two incretin hormones: Similarities and differences. J Diabetes Investig. 2010 Apr 22;1(1-2):8-23. [Content Brief]
[3]. Kim SJ, et al. Resistin is a key mediator of glucose-dependent insulinotropic polypeptide (GIP) stimulation of lipoprotein lipase (LPL) activity in adipocytes. J Biol Chem. 2007 Nov 23;282(47):34139-47. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.1999 mL | 0.9993 mL | 1.9986 mL | 4.9964 mL |
| 5 mM | 0.0400 mL | 0.1999 mL | 0.3997 mL | 0.9993 mL | |
| 10 mM | 0.0200 mL | 0.0999 mL | 0.1999 mL | 0.4996 mL | |
| 15 mM | 0.0133 mL | 0.0666 mL | 0.1332 mL | 0.3331 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
GIP (mouse) Related Classifications
HY-P10735 Related Classifications
Powered by Bioz