1. Recombinant Proteins
  2. 15-PGDH/HPGD Protein, Human (HEK 293, His)

15-PGDH/HPGD Protein, Human (HEK 293, His)

Cat. No.: HY-P70297
Handling Instructions

15-PGDH/HPGD Protein, Human (HEK 293, His) is a recombinant human 15-PGDH/HPGD Protein expressed in HEK293 with a His tag at the N-terminus. 15-PGDH/HPGD, a key enzyme in the degradation of prostaglandins, plays an important role in the development of inflammation-related diseases[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $170 Ask For Quote & Lead Time
50 μg $510 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHu15-hydroxyprostaglandin dehydrogenase [NAD(+)]/HPGD, His; 15-Hydroxyprostaglandin Dehydrogenase [NAD(+)]; 15-PGDH; Prostaglandin Dehydrogenase 1; HPGD; PGDH1
Species

Human

Source

HEK 293

Accession

P15428 (M1-Q266)

Gene ID

3248

Molecular Weight

Approximately 29.0 kDa

AA Sequence

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

15-PGDH/HPGD, a key enzyme in the degradation of prostaglandins, including prostaglandin E2 (PGE2), can catalyze the conversion of 15-hydroxy group of PGE2 into a 15-keto group to produce a biologically inactive PG and antagonize the function of prostaglandin synthase COX-2[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
15-PGDH/HPGD Protein, Human (HEK 293, His)
Cat. No.:
HY-P70297
Quantity:
MCE Japan Authorized Agent: