Copy Link Print Information

15-PGDH/HPGD Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

15-PGDH/HPGD Protein, Human (HEK 293, His) is a recombinant human 15-PGDH/HPGD Protein expressed in HEK293 with a His tag at the N-terminus. 15-PGDH/HPGD, a key enzyme in the degradation of prostaglandins, plays an important role in the development of inflammation-related diseases.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for 15-PGDH/HPGD Protein, Human (HEK293, His)
  • 15-PGDH/HPGD Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

15-PGDH/HPGD Protein, Human (HEK 293, His) is a recombinant human 15-PGDH/HPGD Protein expressed in HEK293 with a His tag at the N-terminus. 15-PGDH/HPGD, a key enzyme in the degradation of prostaglandins, plays an important role in the development of inflammation-related diseases[1].

Background

15-PGDH/HPGD, a key enzyme in the degradation of prostaglandins, including prostaglandin E2 (PGE2), can catalyze the conversion of 15-hydroxy group of PGE2 into a 15-keto group to produce a biologically inactive PG and antagonize the function of prostaglandin synthase COX-2[1].

Verified Bioactivity

Measure by the production of NADH during the oxidation of PGF2 alpha (HY-12956A) of 0.4 mM that incubate at room temperature in kinetic mode for 5 minutes. The specific activity is > 1500 pmol/min/μg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P15428-1 (M1-Q266)

  • Gene ID
    3248  [NCBI]
  • Molecular Construction
    • N-term
    • 15-PGDH (M1-Q266)
      Accession # P15428-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    HPGD; Hydroxyprostaglandin Dehydrogenase 15-(NAD); 15-Hydroxyprostaglandin Dehydrogenase; 15-PGDH; SDR36C1; PGDH1; 15-Hydroxyprostaglandin Dehydrogenase [NAD(+)]; Short Chain Dehydrogenase/Reductase Family 36C, Member 1; Prostaglandin Dehydrogenase 1; NAD+-Dependent 15-Hydroxyprostaglandin Dehydrogenase; Short Chain Dehydrogenase/Reductase Family 36C Member 1; Eicosanoid/Docosanoid Dehydrogenase; 15-Hydroxyprostaglandin Dehydrogenase (NAD(+)); PHOAR1; Eicosanoid/Docosanoid Dehydrogenase [NAD(+)]; PGDH

  • AA Sequence

    MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

  • Predicted Molecular Mass

    29.8 kDa

  • Molecular Weight

    Approximately 29 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution in 20 mM HEPES, 150 mM NaCl, 2 mM DTT, pH 7.4, 20% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

[1]. Shuying Miao, et al.Pharmacologic Blockade of 15-PGDH Protects Against Acute Renal Injury Induced by LPS in Mice. Front Physiol. 2020 Mar 13;11:138. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 15-PGDH/HPGD Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for 15-PGDH/HPGD Protein, Human (HEK293, His)
  • 15-PGDH/HPGD Protein, Human (HEK293, His) Product Image