1. Recombinant Proteins
  2. Others
  3. 26 kDa secreted antigen/TES-26 Protein, Canine (P.pastoris, His)

26 kDa secreted antigen/TES-26 Protein, Canine (P.pastoris, His)

Cat. No.: HY-P71803
Handling Instructions

26 kDa secreted antigen/TES-26 Protein, Canine (P.pastoris, His) is a recombinant canine 26 kDa secreted antigen/TES-26 Protein expressed in P.pastoris with a His tag at the N-terminus. Recombinant TES-26 is a potential diagnostic candidate antigen for human toxocarosis caused by migrating T. canis larvae.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

26 kDa secreted antigen/TES-26 Protein, Canine (P.pastoris, His) is a recombinant canine 26 kDa secreted antigen/TES-26 Protein expressed in P.pastoris with a His tag at the N-terminus. Recombinant TES-26 is a potential diagnostic candidate antigen for human toxocarosis caused by migrating T. canis larvae[1].

Background

The recombinant TES-26 antigen shows high specificity and cross-reacted with T. gondii infection sera only (Toxoplasma gondii, Plasmodium vivax, Entamoeba histolytica, hydatid and hookworm infections.)[1].

Species

Canine

Source

P. pastoris

Tag

N-His

Accession

P54190 (22Q-262A)

Gene ID

/

Molecular Construction
N-term
His
TES26/26 kDa (22Q-262A)
Accession # P54190
C-term
Synonyms
TES-2626kDa secreted antigen; Toxocara excretory-secretory antigen 26; TES-26
AA Sequence

QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA

Molecular Weight

Approximately 27.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

26 kDa secreted antigen/TES-26 Protein, Canine (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
26 kDa secreted antigen/TES-26 Protein, Canine (P.pastoris, His)
Cat. No.:
HY-P71803
Quantity:
MCE Japan Authorized Agent: