1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. TGF-beta Superfamily Receptor Serine/Threonine Kinases Cytokine Receptors Serine/Threonine Kinase Proteins
  4. Activin/Inhibins Receptor
  5. ALK-2/ACVR1
  6. ACVR1 Protein, Canine (HEK293, Fc)

Activin A receptor, type I (ACVR1), also known as ALK-2, is a bone morphogenetic protein (BMP) type I receptor. ACVR1 is involved in a wide variety of biological processes, including bone, heart, cartilage, nervous, and reproductive system development and regulation. ACVR1 Protein, Canine (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Activin A receptor, type I (ACVR1), also known as ALK-2, is a bone morphogenetic protein (BMP) type I receptor. ACVR1 is involved in a wide variety of biological processes, including bone, heart, cartilage, nervous, and reproductive system development and regulation[1]. ACVR1 Protein, Canine (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag.

Background

Activin A receptor type I (ACVR1) gene, also known as ALK-2, is located in chromosome 2q23-q24 and encodes for the 509 amino acid protein. The ACVR1 protein product is initially described as an activin type I receptor, and it is found to be expressed in several tissues and different human cell lines[1].
The sequence of amino acids in ACVR1 proteins from different species is very stable, which leads to the conclusion that in the process of evolution, ACVR1 has been only slightly altered, and that both in humans and in animals, its function is similar.
As a member of the BMP/TGFβ receptor family, the ACVR1 protein contains an extracellular N-terminal ligand-binding domain, a transmembrane (TM) domain, an intracellular glycine-serine-rich (GS) domain, and a protein kinase (PK) domain. The loop positioned in the helix-loop-helix of the GS domain contains the key residues responsible for ACVR1 activation upon phosphorylation. As a type I receptor, ACVR1 forms heterotetrameric receptor complexes with the type II receptors BMPR2, ACVR2A, and ACVR2B. Such complexes consist of two type I and two type II receptors. Upon binding of ligands to the heteromeric complexes, type II receptors transphosphorylate the GS domain of type I receptors. As a result, the kinase domain of type I receptors is activated and subsequently phosphorylates SMAD1/5/8 proteins that transduce the signal. ACVR1 is first described to bind to activin A, a member of the BMP/TGFβ family that usually triggers phosphorylation and activation of SMAD2/3 upon complex formation with type II receptors. Later, ACVR1 is also found to bind several BMPs with distinct affinities, triggering SMAD1/5/8 signalling. Besides canonical SMAD signalling, ACVR1 can activate non-canonical signalling pathways, such as p38 mitogen-activated protein kinases/MAPKs[1].
ACVR1 is involved in a wide variety of biological processes, including bone, heart, cartilage, nervous, and reproductive system development and regulation. Moreover, ACVR1 has been extensively studied for its causal role in fibrodysplasia ossificans progressiva (FOP). ACVR1 is linked to different pathologies, including cardiac malformations and alterations in the reproductive system. More recently, ACVR1 has been experimentally validated as a cancer driver gene in diffuse intrinsic pontine glioma (DIPG)[1].

In Vitro

Recombinant human ACVR1 (2.5-5 μg/mL) robustly down-regulates phosphorylated Smad1/5/8 and p38 MAPK levels in the HUVECR26H cells. ACVR1 also inhibits chondro-osseous differentiation in HUVECR26H cells[2].

Species

Canine

Source

HEK293

Tag

C-hFc

Accession

A0A811ZNW1/XP_549615.2 (M21-E123)

Gene ID
Molecular Construction
N-term
ACVR1 (M21-E123)
Accession # A0A811ZNW1/XP_549615.2
hFc
C-term
Protein Length

Partial

Synonyms
Activin receptor type-1; ACTR-I; SKR1; TSR-I; TSK-7L; Acvrlk2; Tgfb1
AA Sequence

MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPETQNFHLE

Predicted Molecular Mass
38.6 kDa
Molecular Weight

Approximately 68 kDa & 44 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ACVR1 Protein, Canine (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ACVR1 Protein, Canine (HEK293, Fc)
Cat. No.:
HY-P76714
Quantity:
MCE Japan Authorized Agent: