ADAM8 Protein, Rhesus Macaque (HEK293, His)

ADAM8 is a transmembrane glycoprotein containing metalloproteinase and disintegrin domains, belonging to the ADAMs family. It has proteolytic, cell adhesion, cell fusion, and cell signaling properties. It is involved in ectodomain shedding of membrane proteins and is associated with inflammation and neurodegeneration. ADAM8 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived ADAM8 protein, expressed by HEK293 , with C-His labeled tag. The total length of ADAM8 Protein, Rhesus Macaque (HEK293, His) is 477 a.a., with molecular weight of ~53.4 KDa.

In response to inflammatory stimuli such as lipopolysaccharide (LPS) and tumor necrosis factor alpha (TNF-α), ADAM8 expression is upregulated in macrophages and activated glial cells (astrocytes and microglia) in the central nervous system (CNS), suggesting its involvement in neuronal-glial signaling. ADAM8 has proteolytic, cell adhesion, cell fusion, and cell signaling properties. It is involved in ectodomain shedding of membrane proteins and is associated with inflammation and neurodegeneration^[1][2].

Measured by its ability to cleave a fluorogenic peptide substrate Mca-PLAQAV-Dpa-RSSSR-NH2. The specific activity is 0.77 pmol/min/μg, as measured under the described conditions.

Rhesus Macaque

HEK293

C-His

XP_002805919 (R21-P497)

100428452  [NCBI]

RPWARVERYEVVLPRRLPGPRVRRALPSHVGLYPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGHPDSAASLSTCAGLRGFFQVGSDLHLIEPLDEGGEGGRHAVYEAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPQPGGSLPSRETRYVELYVVADNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNRQDRFHVSPHPDVTLENLLAWQAQRLTQRHLQDNVQLITGVDFTGTTVGLARVSAMCSHGSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCHCREPTEAGRCIMAGSIGSTFPRMFSDCSRAYLEGFLEQPQSACLANAPDLSHLVGGPVCGNLFVERGEQCDCGPPEDCRNHCCNSTTCQLAEGAQCAHGTCCQECRVKPAGELCRPKKDTCDLEEFCDGRHPECPEDAFQENGTP

Approximately 53.4 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 12.5 mM Tris, 5 mM CaCl2, 75 mM NaCl, 50% glycerol or 12 mM Tris-HCL, 5 mM CaCl2, 75 mM NaCl, pH 7.4, 50% Glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.