ADAM8 Protein, Rhesus Macaque (HEK293, His)

ADAM8 is a transmembrane glycoprotein containing metalloproteinase and disintegrin domains, belonging to the ADAMs family. It has proteolytic, cell adhesion, cell fusion, and cell signaling properties. It is involved in ectodomain shedding of membrane proteins and is associated with inflammation and neurodegeneration. ADAM8 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived ADAM8 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ADAM8 is a transmembrane glycoprotein containing metalloproteinase and disintegrin domains, belonging to the ADAMs family. It has proteolytic, cell adhesion, cell fusion, and cell signaling properties. It is involved in ectodomain shedding of membrane proteins and is associated with inflammation and neurodegeneration. ADAM8 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived ADAM8 protein, expressed by HEK293 , with C-His labeled tag.

Background

In response to inflammatory stimuli such as lipopolysaccharide (LPS) and tumor necrosis factor alpha (TNF-α), ADAM8 expression is upregulated in macrophages and activated glial cells (astrocytes and microglia) in the central nervous system (CNS), suggesting its involvement in neuronal-glial signaling. ADAM8 has proteolytic, cell adhesion, cell fusion, and cell signaling properties. It is involved in ectodomain shedding of membrane proteins and is associated with inflammation and neurodegeneration[1][2].

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Assay Procedure

Materials
Assay buffer: 50 mM Tris, 10 mM CaCl2, 150 mM NaCl, pH 7.5 (TCN)
ADAM8 Protein, Rhesus Macaque (HEK293, His) (HY-P772930)
Bacterial Thermolysin
Phosphoramidon: Dissolve in methanol to a concentration of 20 mM Substrate: Mca-PLAQAV-Dpa-RSSSR-NH2 (HY-P3722A)
Standard: MCA-Pro-Leu-OH

Procedure
1. Standard curve preparation: Dilute MCA-Pro-Leu-OH (standard) in assay buffer to the following concentrations: 100, 50, 25, 12.5, 6.25, 3.125, 1.5625, 0.78, 0.39, 0.19, 0 pmoL. Add 100 μL of each standard concentration to a 96-well plate. Read in kinetic mode for 5 minutes at excitation and emission wavelengths of 320 nm and 405 nm, respectively. Plot the standard concentration on the x-axis and the measured RFU on the y-axis to generate a standard curve and obtain the standard curve equation.
2. Dilute the test protein to 400 μg/mL in assay buffer.
3. Mix equal volumes of 1.5 μg/mL Thermolysin and diluted test protein.
4. Incubate at 37°C for 30 minutes.
5. Add Phosphoramidon to a final concentration of 0.05 mM to stop the reaction.
6. Incubate at room temperature for 15 minutes.
7. Dilute the activated test protein to 40 ng/μL in assay buffer.
8. Dilute the substrate to 40 μM in assay buffer.
9. Load 50 μL of 40 ng/μL test protein into a black plate and add 50 μL of 40 μM substrate. For the blank, add 50 μL of assay buffer and 50 μL of 40 μM substrate.
10. Read in kinetic mode for 5 minutes at excitation and emission wavelengths of 320 nm and 405 nm, respectively.
11. Calculate the specific activity:

     Specific Activity (pmol/min/μg) =

Adjusted Vmax* (RFU/min) x Conversion Factor ** (pmol/RFU)
amount of enzyme (μg)

*Adjusted for Control
**Derived using calibration standard

Per Well:
Rhesus Macaque ADAM8: 2 μg
Substrate: 20 μM

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ADAM8 (R21-P497)
      Accession # XP_002805919
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    ADAM8; Cell Surface Antigen MS2; ADAM Metallopeptidase Domain 8; CDNA, FLJ93272, Highly Similar To Homo Sapiens A Disintegrin And Metalloproteinase Domain 8 (ADAM8),MRNA; MS2; Human Leukocyte Differentiation Antigen; CD156A; CD156a Antigen; CD156; ADAM8 P

  • AA Sequence

    RPWARVERYEVVLPRRLPGPRVRRALPSHVGLYPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGHPDSAASLSTCAGLRGFFQVGSDLHLIEPLDEGGEGGRHAVYEAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPQPGGSLPSRETRYVELYVVADNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNRQDRFHVSPHPDVTLENLLAWQAQRLTQRHLQDNVQLITGVDFTGTTVGLARVSAMCSHGSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCHCREPSEAGRCIMAGSIGSTFPRMFSDCSRAYLEGFLEQPQSACLTNAPDLSHLVGGPVCGNLFVERGEQCDCGPPEDCRNHCCNSTTCQLAEGAQCAHGTCCQECRVKPAGELCRPKKDTCDLEEFCDGRHPECPEDAFQENGTP

  • Molecular Weight

    55-60kDa.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00