1. Recombinant Proteins
  2. Others
  3. Adiponectin/Acrp30 Protein, Mouse (144a.a)

Adiponectin/Acrp30 Protein, Mouse (144a.a)

Cat. No.: HY-P7358
Handling Instructions

Adiponectin/Acrp30 Protein, Mouse (144a.a) is an adipose-derived hormone, plays an important role in regulating energy homeostasis and insulin sensitivity.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $390 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Adiponectin/Acrp30 Protein, Mouse (144a.a) Featured Recommendations:

Top Publications Citing Use of Products

Adiponectin/Acrp30 Protein, Mouse (144a.a) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

E. coli

Accession

Q60994 (K104-N247)

Gene ID

11450

Synonyms
rMugAcrp30/Adipolean; Adiponectin; ACRP30; APM-1; ADIPOQ; ACDC
AA Sequence

KGEPGEAAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

Molecular Weight

Approximately 16.5 kDa

Biological Activity
The ED50 is <2 µg/mL as measured by M1 cells, corresponding to a specific activity of >500 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Adiponectin is a 30-kDa adipose-derived hormone that appears to play an important role in regulating energy homeostasis and insulin sensitivity. The globular head group of adiponectin (gAcrp30) reduces plasma glucose levels and ameliorates insulin resistance in mice[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adiponectin/Acrp30 Protein, Mouse (144a.a)
Cat. No.:
HY-P7358
Quantity:
MCE Japan Authorized Agent: