1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Adiponectin
  5. Adiponectin/Acrp30 Protein, Mouse (144a.a)

Adiponectin/Acrp30 Protein, Mouse (144a.a) is an adipose-derived hormone, plays an important role in regulating energy homeostasis and insulin sensitivity.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Adiponectin/Acrp30 Protein, Mouse (144a.a)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Adiponectin/Acrp30 Protein, Mouse (144a.a) is an adipose-derived hormone, plays an important role in regulating energy homeostasis and insulin sensitivity.

Background

Adiponectin is a 30-kDa adipose-derived hormone that appears to play an important role in regulating energy homeostasis and insulin sensitivity. The globular head group of adiponectin (gAcrp30) reduces plasma glucose levels and ameliorates insulin resistance in mice[1].

Biological Activity

1.The ED50 is <2 µg/mL as measured by M1 cells, corresponding to a specific activity of >500 units/mg.
2.Measured by its ability to induce TIMP-1 secretion by RAW264.7 mouse macrophages cell. The ED50 for this effect is 12.01 μg/mL, Corresponding to a specific is 83.234 U/mg

  • Measured by its ability to induce TIMP-1 secretion by RAW264.7 mouse macrophages cell. The ED50 for this effect is 12.01 μg/mL, Corresponding to a specific activity is 83.234 U/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q60994 (K104-N247,V113M)

Gene ID
Molecular Construction
N-term
Acrp30 (K104-N247)
Accession # Q60994
C-term
Protein Length

Partial

Synonyms
rMugAcrp30/Adipolean; Adiponectin; ACRP30; APM-1; ADIPOQ; ACDC
AA Sequence

KGEPGEAAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

Molecular Weight

Approximately 16.5-19 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Adiponectin/Acrp30 Protein, Mouse (144a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adiponectin/Acrp30 Protein, Mouse (144a.a)
Cat. No.:
HY-P7358
Quantity:
MCE Japan Authorized Agent: