Adiponectin/Acrp30 Protein, Mouse (V113M, 144a.a)
Based on 1 publication(s) in Google Scholar
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Background
Adiponectin is a 30-kDa adipose-derived hormone that appears to play an important role in regulating energy homeostasis and insulin sensitivity. The globular head group of adiponectin (gAcrp30) reduces plasma glucose levels and ameliorates insulin resistance in mice[1].
Verified Bioactivity
1.The ED50 is <2 µg/mL as measured by M1 cells, corresponding to a specific activity of >500 units/mg.
2.Measured by its ability to induce TIMP-1 secretion by RAW264.7 mouse macrophages cell. The ED50 for this effect is 12.01 μg/mL, Corresponding to a specific is 83.234 U/mg
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Inflamm Res
Unleashing AdipoRon's Potential: A Fresh Approach to Tackle Pseudomonas aeruginosa Infections in Bronchiectasis via Sphingosine Metabolism Modulation. [Abstract]2024 Oct 24:17:7653-7674. PMID: 39469062
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q60994 (K104-N247, V113M)
-
Molecular Construction
-
N-term
-
Acrp30 (K104-N247, V113M)
Accession # Q60994 -
C-term
-
-
Protein Length
Partial
-
Synonyms
ADIPOQ; Adipocyte, C1Q And Collagen Domain Containing; Prev. ACDC; Adipose Specific Collagen-Like Factor; Adiponectin; Gelatin-Binding Protein 28; ACRP30; Gelatin-Binding Protein; GBP28; Adiponectin Precursor; ApM1; ADIPQTL1; Adipose Most Abundant Gene Tr
-
AA Sequence
KGEPGEAAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)