Adrenomedullin/ADM Protein, Human (HEK293, Fc)

Adrenomedullin (ADM) and PAMP are potent hypotensive and vasodilator agents that mainly affect fluid and electrolyte homeostasis. In the kidney, ADM has diuretic and natriuretic effects, while both ADM and PAMP directly inhibit aldosterone secretion in the adrenal gland. Adrenomedullin/ADM Protein, Human (HEK293, Fc) is the recombinant human-derived Adrenomedullin/ADM protein, expressed by HEK293 , with N-hFc labeled tag.

Adrenomedullin (ADM) and PAMP are potent hypotensive and vasodilatory agents with numerous reported actions primarily linked to the physiological control of fluid and electrolyte homeostasis. In the kidney, ADM exhibits diuretic and natriuretic effects, while both ADM and PAMP inhibit aldosterone secretion through direct actions on the adrenal glands. In the pituitary gland, both peptides, at physiologically relevant doses, inhibit basal ACTH secretion. Furthermore, ADM and PAMP seem to act in the brain and pituitary gland, facilitating the loss of plasma volume, actions that complement their hypotensive effects in blood vessels. These multifaceted actions underscore the role of ADM in regulating cardiovascular and hormonal processes associated with fluid and electrolyte balance.

Human

HEK293

N-hFc

P35318 (Y95-Y146)

133  [NCBI]

Full Length of mature protein?

YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY

Approximately 34-39 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.