1. Recombinant Proteins
  2. AG-2 Protein, Human (HEK293, His)

AG-2 Protein, Human (HEK293, His)

Cat. No.: HY-P7465
Handling Instructions

AG-2 Protein, Human (HEK293, His) is human recombinant AG-2 with a N-terminal His tag. AG-2 Protein, Human (HEK293, His) is expressed in HEK293 cells.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $160 Ask For Quote & Lead Time
50 μg $490 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuAG-2, His; HPC8; AGR2; AG2
Species

Human

Source

HEK 293

Accession

O95994 (R21-L175)

Gene ID

10551

Molecular Weight

Approximately 18.0 kDa

AA Sequence

RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTELHHHHHH

Biological Activity
Data is not available.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 20 mM Tris, 200 mM NaCl, 10% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

AG-2 (Anterior gradient 2) is a human ortholog of the Xenopus laevis cement gland protein and a member of the protein disulfide isomerase (PDI) family. AG-2 is highly expressed and secreted in malignant cancer types, including breast carcinomas, pancreatic cancer, glioblastoma, prostate cancer and metastatic colorectal cancer. AGR2 is also a pro-oncogenic protein that stimulates EGFR ligand amphiregulin, regulate p53 signaling, and interact with the AAA+ protein Reptin. Overexpressed AG-2 stabilizes HIF-1α in tumor cells[1][2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AG-2 Protein, Human (HEK293, His)
Cat. No.:
HY-P7465
Quantity:
MCE Japan Authorized Agent: