AG-2 Protein, Human (HEK293, His, solution)
Based on 1 Customer Validation
AG-2 Protein, Human (HEK293, His, solution) is human recombinant AG-2 with a N-terminal His tag. AG-2 Protein, Human (HEK293, His) is expressed in HEK293 cells.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
AG-2 Protein, Human (HEK293, His, solution) is human recombinant AG-2 with a N-terminal His tag. AG-2 Protein, Human (HEK293, His) is expressed in HEK293 cells.
Background
AG-2 (Anterior gradient 2) is a human ortholog of the Xenopus laevis cement gland protein and a member of the protein disulfide isomerase (PDI) family. AG-2 is highly expressed and secreted in malignant cancer types, including breast carcinomas, pancreatic cancer, glioblastoma, prostate cancer and metastatic colorectal cancer. AGR2 is also a pro-oncogenic protein that stimulates EGFR ligand amphiregulin, regulate p53 signaling, and interact with the AAA+ protein Reptin. Overexpressed AG-2 stabilizes HIF-1α in tumor cells[1][2].
Verified Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of PC-3 human prostate cancer cells. The ED50 for this effect is 0.6041 μg/mL, corresponding to a specific activity is 1655.355 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
O95994 (R21-L175)
-
Molecular Construction
-
N-term
-
AG-2 (R21-L175)
Accession # O95994 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
AGR2; Epididymis Secretory Protein Li 116; Anterior Gradient 2, Protein Disulphide Isomerase Family Member; HEL-S-116; HAG-2; AG-2; AG2; HPC8; PDIA17; Anterior Gradient 2 Splice Variant C; XAG-2; Secreted Cement Gland Homolog; Protein Disulfide Isomerase
-
AA Sequence
RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
-
Predicted Molecular Mass
18.9 kDa
-
Molecular Weight
Approximately 16-21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 200 mM NaCl, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Pan F, et al. Anterior gradient 2 as a supervisory marker for tumor vessel normalization induced by anti-angiogenic treatment. Oncol Lett. 2018 Sep;16(3):3083-3091. [Content Brief]
[2]. Luu TT, et al. Overexpression of AGR2 Is Associated With Drug Resistance in Mutant Non-small Cell Lung Cancers. Anticancer Res. 2020 Apr;40(4):1855-1866. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
