1. Recombinant Proteins
  2. Others
  3. AG-2 Protein, Human (HEK293, His)

AG-2 Protein, Human (HEK293, His)

Cat. No.: HY-P7465
COA Handling Instructions

AG-2 Protein, Human (HEK293, His) is human recombinant AG-2 with a N-terminal His tag. AG-2 Protein, Human (HEK293, His) is expressed in HEK293 cells.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $125 In-stock
50 μg $350 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

AG-2 Protein, Human (HEK293, His) is human recombinant AG-2 with a N-terminal His tag. AG-2 Protein, Human (HEK293, His) is expressed in HEK293 cells.

Background

AG-2 (Anterior gradient 2) is a human ortholog of the Xenopus laevis cement gland protein and a member of the protein disulfide isomerase (PDI) family. AG-2 is highly expressed and secreted in malignant cancer types, including breast carcinomas, pancreatic cancer, glioblastoma, prostate cancer and metastatic colorectal cancer. AGR2 is also a pro-oncogenic protein that stimulates EGFR ligand amphiregulin, regulate p53 signaling, and interact with the AAA+ protein Reptin. Overexpressed AG-2 stabilizes HIF-1α in tumor cells[1][2].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O95994 (R21-L175)

Gene ID
Synonyms
rHuAG-2, His; HPC8; AGR2; AG2
AA Sequence

RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTELHHHHHH

Molecular Weight

Approximately 18.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filter solution of 20 mM Tris, 200 mM NaCl, 10% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

AG-2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AG-2 Protein, Human (HEK293, His)
Cat. No.:
HY-P7465
Quantity:
MCE Japan Authorized Agent: