AKR1C2 Protein, Human (His)
Based on 1 Customer Validation
AKR1C2 protein: Cytoplasmic aldehyde-keto reductase, which uses NADH and NADPH to reduce ketosteroids to hydroxysteroids. AKR1C2 Protein, Human (His) is the recombinant human-derived AKR1C2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
AKR1C2 protein: Cytoplasmic aldehyde-keto reductase, which uses NADH and NADPH to reduce ketosteroids to hydroxysteroids. AKR1C2 Protein, Human (His) is the recombinant human-derived AKR1C2 protein, expressed by E. coli , with N-6*His labeled tag.
Background
AKR1C2 Protein is a cytosolic aldo-keto reductase that plays a pivotal role in catalyzing the NADH and NADPH-dependent reduction of ketosteroids to hydroxysteroids. This enzyme exhibits a likely reductase function in vivo, as evidenced by the inhibition of its oxidase activity in vitro by physiological concentrations of NADPH. AKR1C2 displays a broad positional specificity, acting on positions 3, 17, and 20 of steroids, thereby regulating the metabolism of hormones such as estrogens and androgens. Collaborating with 5-alpha/5-beta-steroid reductases, it contributes to the conversion of steroid hormones into 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Furthermore, AKR1C2 catalyzes the inactivation of the potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Specifically, it is capable of producing 17beta-hydroxy-5alpha-androstan-3-one/5alphaDHT and may also reduce conjugated steroids, such as 5alpha-dihydrotestosterone sulfate. Additionally, the protein exhibits an affinity for bile acids, further emphasizing its involvement in diverse metabolic pathways.
Verified Bioactivity
Measured by its ability to oxidize S-1-indanol in the presence of NADP+ that incubate at roomtemperature in kinetic mode for 5 minutes. The specific activity is 54.55 pmol/min/µg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P52895 (M1-Y323)
-
Molecular Construction
-
N-term
-
6*His
-
AKR1C2 (M1-Y323)
Accession # P52895 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
AKR1C2; DD/BABP; Prev. DDH2; Aldo-Keto Reductase Family 1, Member C2 (Dihydrodiol Dehydrogenase 2; Bile Acid Binding Protein; 3-Alpha Hydroxysteroid Dehydrogenase, Type III); Prev. TDD; Dihydrodiol Dehydrogenase/Bile Acid-Binding Protein; DD2; Trans-1,2-D
-
AA Sequence
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
-
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
