Alpha-2-Antiplasmin/Serpin F2 Protein, Mouse (HEK293, His)

Alpha-2-Antiplasmin/Serpin F2 Protein, a serine protease inhibitor, targets plasmin and trypsin, also inhibiting matriptase-3/TMPRSS7 and chymotrypsin.It forms a heterodimer with TMPRSS7, enhancing its protease inhibiting activity.Alpha-2-Antiplasmin/Serpin F2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Alpha-2-Antiplasmin/Serpin F2 protein, expressed by HEK293 , with C-6*His labeled tag.

Alpha-2-Antiplasmin/Serpin F2 Protein is a serine protease inhibitor that primarily targets plasmin and trypsin, while also inhibiting matriptase-3/TMPRSS7 and chymotrypsin. Additionally, it forms a heterodimer with TMPRSS7 to further enhance its protease inhibiting activity.

Mouse

HEK293

C-6*His

Q61247 (V28-K491)

18816  [NCBI]

Full Length of Mature Protein

VDLPGQQPVSEQAQQKLPLPALFKLDNQDFGDHATLKRSPGHCKSVPTAEETRRLAQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGAQNQTLHSLHRVLHMNTGSCLPHLLSHFYQNLGPGTIRLAARIYLQKGFPIKDDFLEQSERLFGAKPVKLTGKQEEDLANINQWVKEATEGKIEDFLSELPDSTVLLLLNAIHFHGFWRTKFDPSLTQKDFFHLDERFTVSVDMMHAVSYPLRWFLLEQPEIQVAHFPFKNNMSFVVVMPTYFEWNVSEVLANLTWDTLYHPSLQERPTKVWLPKLHLQQQLDLVATLSQLGLQELFQGPDLRGISEQNLVVSSVQHQSTMELSEAGVEAAAATSVAMNRMSLSSFTVNRPFLFFIMEDTIGVPLFVGSVRNPNPSALPQLQEQRDSPDNRLIGQNDKADFHGGKTFGPDLKLAPRMEEDYPQFSSPK

70-85 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 20% glycerol, 1 mM DTT, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.