Animal-Free BMP-10 Protein, Human (His)

BMP-10 is essential for embryonic cardiomyocyte proliferation, preventing premature activation of CDKN1C/p57KIP and ensuring optimal expression of MEF2C and NKX2-5. As a ligand for AVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, it activates SMAD1, SMAD5 and SMAD8, regulating key signaling pathways. Animal-Free BMP-10 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-10 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free BMP-10 Protein, Human (His) is 108 a.a., with molecular weight of ~13.10 kDa.

BMP-10 is vital for maintaining the proliferative activity of embryonic cardiomyocytes, preventing premature activation of the negative cell cycle regulator CDKN1C/p57KIP, and ensuring the necessary expression levels of cardiogenic factors like MEF2C and NKX2-5. Functioning as a ligand for ACVRL1/ALK1, BMPR1A/ALK3, and BMPR1B/ALK6, it triggers the activation of SMAD1, SMAD5, and SMAD8 transcription factors, orchestrating crucial signaling pathways. Additionally, BMP-10 exhibits inhibitory effects on endothelial cell migration and growth, and in breast cancer cell lines, it may attenuate both cell migration and cell matrix adhesion. Structurally, it forms a homodimer linked by disulfide bonds. Notably, BMP-10 interacts with extracellular matrix proteins FBN1 and FBN2 through its N-terminal domain and engages with ENG, further underscoring its multifaceted roles in various cellular processes.

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is 1.7-2.1 ng/mL.

Human

E. coli

C-His

O95393 (N317-R424)

27302  [NCBI]

MNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR

Approximately 13.10 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 MNaCl, pH 3.5.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.