Animal-Free EGF Protein, Pig (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The EGF protein acts as a potent stimulator of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings and exhibits growth-promoting effects on certain fibroblasts in cell culture. Animal-Free EGF Protein, Pig (His) is the recombinant pig-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Pig
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The EGF protein acts as a potent stimulator of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings and exhibits growth-promoting effects on certain fibroblasts in cell culture. Animal-Free EGF Protein, Pig (His) is the recombinant pig-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Background

EGF Protein serves as a potent stimulator of the growth of diverse epidermal and epithelial tissues in both in vivo and in vitro settings, and it exhibits growth-promoting effects on certain fibroblasts in cell culture. In addition to its role in tissue growth, this protein functions as a magnesiotropic hormone, actively promoting magnesium reabsorption in the renal distal convoluted tubule by engaging EGFR and activating the magnesium channel TRPM6, as suggested by similarity. Furthermore, EGF Protein engages in molecular interactions such as binding to EGFR, facilitating EGFR dimerization, and interacting with RHBDF1. The latter interaction may contribute to the potential retention of EGF in the endoplasmic reticulum, regulating its degradation through endoplasmic reticulum-associated degradation (ERAD). Additionally, its interaction with RHBDF2 hints at a multifaceted role in cellular processes, further highlighting the versatility of EGF Protein in various molecular pathways.

Technical Parameters

  • Species Pig
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • EGF (N970-R1022)
      Accession # Q00968
    • 6*His
    • C-term
  • Protein Length

    Full Length of Epidermal growth factor Chain

  • Synonyms

    EGF; Alternative Protein EGF; Epidermal Growth Factor; Beta-Urogastrone; Pro-Epidermal Growth Factor; HOMG4; Epidermal Growth Factor (Beta-Urogastrone); URG

  • AA Sequence

    NSYSECPPSHDGYCLHGGVCMYIEAVDSYACNCVFGYVGERCQHRDLKWWELR

  • Predicted Molecular Mass

    7.1 kDa

  • Molecular Weight

    Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00