Animal-Free EGF Protein, Pig (His)
Based on 1 publication(s) in Google Scholar
The EGF protein acts as a potent stimulator of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings and exhibits growth-promoting effects on certain fibroblasts in cell culture. Animal-Free EGF Protein, Pig (His) is the recombinant pig-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.
- Species: Pig
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The EGF protein acts as a potent stimulator of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings and exhibits growth-promoting effects on certain fibroblasts in cell culture. Animal-Free EGF Protein, Pig (His) is the recombinant pig-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.
Background
EGF Protein serves as a potent stimulator of the growth of diverse epidermal and epithelial tissues in both in vivo and in vitro settings, and it exhibits growth-promoting effects on certain fibroblasts in cell culture. In addition to its role in tissue growth, this protein functions as a magnesiotropic hormone, actively promoting magnesium reabsorption in the renal distal convoluted tubule by engaging EGFR and activating the magnesium channel TRPM6, as suggested by similarity. Furthermore, EGF Protein engages in molecular interactions such as binding to EGFR, facilitating EGFR dimerization, and interacting with RHBDF1. The latter interaction may contribute to the potential retention of EGF in the endoplasmic reticulum, regulating its degradation through endoplasmic reticulum-associated degradation (ERAD). Additionally, its interaction with RHBDF2 hints at a multifaceted role in cellular processes, further highlighting the versatility of EGF Protein in various molecular pathways.
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Pig
-
Source E. coli
-
Tag C-6*His
-
Accession
Q00968 (N970-R1022)
-
Molecular Construction
-
N-term
-
EGF (N970-R1022)
Accession # Q00968 -
6*His
-
C-term
-
-
Protein Length
Full Length of Epidermal growth factor Chain
-
Synonyms
EGF; Alternative Protein EGF; Epidermal Growth Factor; Beta-Urogastrone; Pro-Epidermal Growth Factor; HOMG4; Epidermal Growth Factor (Beta-Urogastrone); URG
-
AA Sequence
NSYSECPPSHDGYCLHGGVCMYIEAVDSYACNCVFGYVGERCQHRDLKWWELR
-
Predicted Molecular Mass
7.1 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)