Animal-Free EGF Protein, Pig (His)

The EGF protein acts as a potent stimulator of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings and exhibits growth-promoting effects on certain fibroblasts in cell culture. Animal-Free EGF Protein, Pig (His) is the recombinant pig-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free EGF Protein, Pig (His) is 53 a.a., with molecular weight of ~7.1 kDa.

EGF Protein serves as a potent stimulator of the growth of diverse epidermal and epithelial tissues in both in vivo and in vitro settings, and it exhibits growth-promoting effects on certain fibroblasts in cell culture. In addition to its role in tissue growth, this protein functions as a magnesiotropic hormone, actively promoting magnesium reabsorption in the renal distal convoluted tubule by engaging EGFR and activating the magnesium channel TRPM6, as suggested by similarity. Furthermore, EGF Protein engages in molecular interactions such as binding to EGFR, facilitating EGFR dimerization, and interacting with RHBDF1. The latter interaction may contribute to the potential retention of EGF in the endoplasmic reticulum, regulating its degradation through endoplasmic reticulum-associated degradation (ERAD). Additionally, its interaction with RHBDF2 hints at a multifaceted role in cellular processes, further highlighting the versatility of EGF Protein in various molecular pathways.

Pig

E. coli

C-His

Q00968 (970-1022)

397083  [NCBI]

MNSYSECPPSHDGYCLHGGVCMYIEAVDSYACNCVFGYVGERCQHRDLKWWELR

Approximately 7.1 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 1X PBS, pH8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.