Animal-Free Fas Ligand Protein, Mouse (His)

Cat. No.: HY-P700176AF: Ficha de datos
COA

SDS
Instrucciones de manejo
FAQs
Technical Support

The cytoplasmic form of Fas ligand protein exerts powerful effects by inhibiting gene transcription. This protein plays a crucial role in regulating cellular processes by inhibiting the expression of specific genes. Animal-Free Fas Ligand Protein, Mouse (His) is the recombinant mouse-derived animal-FreeFas Ligand protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service Protein Expression Service

Tamaño	Stock	Cantidad
Muestra gratis	Apply now
2 μg	En stock	Estimated Time of Arrival: December 31
10 μg	En stock	Estimated Time of Arrival: December 31
50 μg	En stock	Estimated Time of Arrival: December 31
100 μg	Obtener un presupuesto

or Consulta para venta a granel

* Seleccione Cantidad antes de agregar artículos.

1 Publications Citing Use of MCE Animal-Free Fas Ligand Protein, Mouse (His)

•J Neuroinflammation. 2025 Mar 4;22(1):62. [Abstract]

Actividad biológica
Technical Parameters
Properties
Descripciòn

Descripciòn	The cytoplasmic form of Fas ligand protein exerts powerful effects by inhibiting gene transcription. This protein plays a crucial role in regulating cellular processes by inhibiting the expression of specific genes. Animal-Free Fas Ligand Protein, Mouse (His) is the recombinant mouse-derived animal-FreeFas Ligand protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Background	Fas Ligand Protein, in its cytoplasmic form, exerts a powerful impact by inhibiting gene transcription. This protein plays a crucial role in regulating cellular processes by suppressing the expression of specific genes. By preventing gene transcription, Fas Ligand Protein can modulate various biological pathways and influence cellular behavior. Understanding the mechanisms by which this protein functions can provide insights into gene regulation and potentially lead to the development of innovative approaches for controlling gene expression in various biological systems.
Actividad biológica	Measure by its ability to induce apoptosis in Jurkat cells. The ED₅₀ for this effect is <1 μg /mL.
Species	Mouse
Source	E. coli
Tag	N-6*His
Accession	Q544E9 (Q128-L279)
Gene ID	14103 [NCBI]
Molecular Construction	N-term 6*His Fas Ligand (Q128-L279) Accession # Q544E9 C-term
Protein Length	Partial
Synonyms	soluble Fas Ligand (sFasL); TNFSF6; CD95L; Apo I Ligand; APTL; APT1LG1; CD178; Fas-Lg; Tnfs; Tnlg1a; gld
AA Sequence	QIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL
Predicted Molecular Mass	18.3 kDa
Peso molecular	Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.
Pureza	≥ 95%, as determined by reducing SDS-PAGE.
Appearance	Lyophilized powder
Formulation	Lyophilized from a solution containing 1X PBS, pH 8.0.
Endotoxin Level	<0.1 EU per 1 μg of the protein by the LAL method.
Reconstitution	It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Storage & Stability	Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Envío	Room temperature in continental US; may vary elsewhere.
Documentación	Select Batch: Ficha de datos (235 KB) SDS (251 KB) COA (220 KB) Instrucciones de manejo (2659 KB)