Animal-Free Fas Ligand Protein, Mouse (His)

Cat. No.: HY-P700176AF: Fiche technique
COA

SDS
Instruction de manipulation
FAQs
Technical Support

The cytoplasmic form of Fas ligand protein exerts powerful effects by inhibiting gene transcription. This protein plays a crucial role in regulating cellular processes by inhibiting the expression of specific genes. Animal-Free Fas Ligand Protein, Mouse (His) is the recombinant mouse-derived animal-FreeFas Ligand protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service Protein Expression Service

Size	Stock	Quantité
Échantillon gratuit	Apply now
2 μg	En stock	Estimated Time of Arrival: December 31
10 μg	En stock	Estimated Time of Arrival: December 31
50 μg	En stock	Estimated Time of Arrival: December 31
100 μg	Obtenir un devis

or Bulk Inquiry

* Veuillez sélectionner la quantité avant d'ajouter des articles.

1 Publications Citing Use of MCE Animal-Free Fas Ligand Protein, Mouse (His)

•J Neuroinflammation. 2025 Mar 4;22(1):62. [Abstract]

Activité biologique
Paramètres Techniques
Propriétés
Description

Description	The cytoplasmic form of Fas ligand protein exerts powerful effects by inhibiting gene transcription. This protein plays a crucial role in regulating cellular processes by inhibiting the expression of specific genes. Animal-Free Fas Ligand Protein, Mouse (His) is the recombinant mouse-derived animal-FreeFas Ligand protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Background	Fas Ligand Protein, in its cytoplasmic form, exerts a powerful impact by inhibiting gene transcription. This protein plays a crucial role in regulating cellular processes by suppressing the expression of specific genes. By preventing gene transcription, Fas Ligand Protein can modulate various biological pathways and influence cellular behavior. Understanding the mechanisms by which this protein functions can provide insights into gene regulation and potentially lead to the development of innovative approaches for controlling gene expression in various biological systems.
Activité biologique	Measure by its ability to induce apoptosis in Jurkat cells. The ED₅₀ for this effect is <1 μg /mL.
Species	Mouse
Source	E. coli
Tag	N-6*His
Accession	Q544E9 (Q128-L279)
Gene ID	14103 [NCBI]
Molecular Construction	N-term 6*His Fas Ligand (Q128-L279) Accession # Q544E9 C-term
Protein Length	Partial
Synonyms	soluble Fas Ligand (sFasL); TNFSF6; CD95L; Apo I Ligand; APTL; APT1LG1; CD178; Fas-Lg; Tnfs; Tnlg1a; gld
AA Sequence	QIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL
Predicted Molecular Mass	18.3 kDa
Masse moléculaire	Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.
Pureté	≥ 95%, as determined by reducing SDS-PAGE.
Appearance	Lyophilized powder
Formulation	Lyophilized from a solution containing 1X PBS, pH 8.0.
Endotoxin Level	<0.1 EU per 1 μg of the protein by the LAL method.
Reconstitution	It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Storage & Stability	Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Livraison	Room temperature in continental US; may vary elsewhere.
Documentation	Select Batch: Fiche technique (235 KB) SDS (251 KB) COA (220 KB) Instruction de manipulation (2659 KB)