Animal-Free FGF-21 Protein, Human (His)

FGF-21 Proteinas, pivotal in promoting glucose uptake in adipocytes, induces SLC2A1/GLUT1 expression, not affecting SLC2A4/GLUT4, contingent on KLB. It significantly regulates systemic glucose homeostasis and insulin sensitivity, with direct KLB interaction via its C-terminus. Engagement with FGFR4 adds complexity to its molecular mechanisms, highlighting its role in orchestrating cellular responses beyond localized effects. Animal-Free FGF-21 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-21 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FGF-21 Protein, Human (His) is 181 a.a., with molecular weight of ~20.35 kDa.

The FGF-21 protein plays a pivotal role in promoting glucose uptake within differentiated adipocytes by specifically inducing the expression of the glucose transporter SLC2A1/GLUT1, while not affecting SLC2A4/GLUT4 expression. Its activity is contingent upon the presence of KLB. Beyond its localized effects, this protein contributes significantly to the regulation of systemic glucose homeostasis and insulin sensitivity. The direct interaction with KLB, facilitated via its C-terminus, underscores the molecular basis of its functionality. Additionally, the protein engages with FGFR4, further highlighting the complexity of its interactions in orchestrating cellular responses.

Measure by its ability to induce proliferation in BaF3 cells transfected with human FGFRIIIc. The ED₅₀ for this effect is <0.4 μg/mL.

Human

E. coli

C-His

Q9NSA1 (H29-S209)

26291  [NCBI]

MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Approximately 20.35 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.