Animal-Free GCP-2/CXCL6 Protein, Human (His)

The GCP-2/CXCL6 protein is a chemokine that eliminates pathogens by attracting neutrophils, basophils, and T cells and is an important mediator in inflammation. It activates neutrophils by binding to the G protein-coupled receptors CXCR1 and CXCR2, which are mainly expressed on neutrophils, monocytes, and endothelial cells. Animal-Free GCP-2/CXCL6 Protein, Human (His) is the recombinant human-derived animal-FreeGCP-2/CXCL6 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free GCP-2/CXCL6 Protein, Human (His) is 75 a.a., with molecular weight of ~8.97 kDa.

CXCL8, a chemotactic factor, serves as a pivotal mediator in the inflammatory response by attracting neutrophils, basophils, and T-cells to eliminate pathogens and safeguard the host from infections. This protein also plays a crucial role in activating neutrophils. Upon release in response to an inflammatory stimulus, CXCL8 exerts its effects by binding to the G-protein-coupled receptors CXCR1 and CXCR2, predominantly expressed in neutrophils, monocytes, and endothelial cells. The binding triggers the release of G-protein heterotrimer (alpha, beta, gamma subunits) from the CXCR1/CXCR2 receptor, leading to the activation of downstream signaling pathways, including PI3K and MAPK pathways. CXCL8's homodimeric structure facilitates its interactions, and it has been shown to interact with TNFAIP6, disrupting chemokine binding to glycosaminoglycans. This multifaceted role underscores the importance of CXCL8 in orchestrating immune responses during inflammation.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <10 ng/mL.

Human

E. coli

N-His

P80162 (V40-N114)

6372  [NCBI]

VSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN

Approximately 8.97 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.