Animal-Free IFN-alpha 1a/IFNA1 Protein, Human (His)

IFN-alpha 1a/IFNA1 Protein, produced by macrophages, demonstrates robust antiviral activities. It stimulates essential enzymes—a protein kinase and an oligoadenylate synthetase—contributing to the intricate molecular response that fortifies the host's immune defenses against viral threats. Animal-Free IFN-alpha 1a/IFNA1 Protein, Human (His) is the recombinant human-derived animal-FreeIFN-alpha 1a/IFNA1 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free IFN-alpha 1a/IFNA1 Protein, Human (His) is 166 a.a., with molecular weight of ~20.19 kDa.

IFN-alpha 1a/IFNA1 Protein, originating from macrophages, exhibits potent antiviral activities. Its key function lies in the stimulation of two critical enzymes—a protein kinase and an oligoadenylate synthetase. This intricate molecular response, orchestrated by IFN-alpha 13, plays a crucial role in fortifying the host's immune defenses against viral threats.

Measure by its ability to inhibit IL-8 secretion in human PBMCs in the presence of LPS. The ED₅₀ for this effect is <1.12 μg /mL.

Human

E. coli

N-His

P01562 (C24-E189)

3439  [NCBI]

CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Approximately 20.19 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.