Animal-Free IL-10 Protein, Human (His)

IL-10 protein is a major immunoregulatory cytokine with profound anti-inflammatory functions that limits excessive tissue destruction caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptors IL10RA and IL10RB, leading to JAK1- and STAT2-mediated phosphorylation of STAT3, which translocates to the nucleus and drives the expression of anti-inflammatory mediators. Animal-Free IL-10 Protein, Human (His) is the recombinant human-derived animal-FreeIL-10 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-10 Protein, Human (His) is 160 a.a., with molecular weight of ~19.6 kDa.

IL-10 Protein, a key immune regulatory cytokine, exerts potent anti-inflammatory effects to prevent excessive tissue damage caused by inflammation. It engages its heterotetrameric receptor, composed of IL10RA and IL10RB, triggering JAK1 and STAT2-mediated phosphorylation of STAT3. This leads to STAT3 translocation into the nucleus, driving the expression of anti-inflammatory mediators. IL-10 Protein targets antigen-presenting cells like macrophages and monocytes, inhibiting the release of pro-inflammatory cytokines. It also hinders antigen presentation by reducing MHC-class II and co-stimulatory molecule expression, thereby dampening T cell activation. Additionally, it reprograms metabolic pathways, including mTOR signaling, to control the inflammatory response of macrophages. The protein forms homodimers and interacts with IL10RA and IL10RB.

Measure by its ability to induce MC/9 - 2 cells proliferation. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant human IL-10 is approximately >1 x10⁶ IU/ mg.

Human

E. coli

C-His

P22301 (S19-N178)

3586  [NCBI]

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Approximately 19.6 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.01 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.