1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-11
  5. Animal-Free IL-11 Protein, Mouse (His)

IL-11 protein is a multifunctional cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation to increase platelet production. It also contributes to liver cell proliferation in response to liver injury. Animal-Free IL-11 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-11 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
2 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

IL-11 protein is a multifunctional cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation to increase platelet production. It also contributes to liver cell proliferation in response to liver injury. Animal-Free IL-11 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-11 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Background

The IL-11 Protein emerges as a versatile cytokine with multifaceted roles, stimulating the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells while inducing megakaryocyte maturation, leading to heightened platelet production. Additionally, IL-11 contributes to hepatocyte proliferation in response to liver damage. Upon binding to its receptor, formed by IL6ST and either IL11RA1 or IL11RA2, IL-11 activates a signaling cascade promoting cell proliferation, a process implicated in various cancers. This signaling triggers the activation of intracellular protein kinases and the phosphorylation of STAT3. Notably, the interaction with membrane-bound IL11RA and IL6ST leads to 'classic signaling,' while the binding of soluble IL11RA to IL6ST stimulates 'trans-signaling.' IL-11 further forms a multimeric signaling complex by interacting with either IL11RA1 or IL11RA2, highlighting its pivotal role in orchestrating diverse cellular responses.

Actividad biológica

Measure by its ability to induce T11 cells proliferation. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse IL-11 is> 2 x 106IU/mg.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P47873 (P22-L199)

Gene ID
Molecular Construction
N-term
6*His
IL-11 (P22-L199)
Accession # P47873
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuInterleukin-11/IL-11, Fc ; Interleukin-11; Il11; IL-11
AA Sequence

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Predicted Molecular Mass
20 kDa
Peso molecular

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

Animal-Free IL-11 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Animal-Free IL-11 Protein, Mouse (His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Animal-Free IL-11 Protein, Mouse (His)
Cat. No.:
HY-P700189AF
Cantidad:
MCE Japan Authorized Agent: