Animal-Free IL-20 Protein, Human (His)
Based on 1 Customer Validation
IL-20 protein is a proinflammatory cytokine secreted by monocytes and keratinocytes that is critical for immune responses, inflammation, hematopoiesis, and epidermal cell differentiation. It plays a key role in tissue remodeling, wound healing, and maintenance of epithelial homeostasis during infection. Animal-Free IL-20 Protein, Human (His) is the recombinant human-derived animal-FreeIL-20 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-20 protein is a proinflammatory cytokine secreted by monocytes and keratinocytes that is critical for immune responses, inflammation, hematopoiesis, and epidermal cell differentiation. It plays a key role in tissue remodeling, wound healing, and maintenance of epithelial homeostasis during infection. Animal-Free IL-20 Protein, Human (His) is the recombinant human-derived animal-FreeIL-20 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Background
IL-20 Protein, a pro-inflammatory and angiogenic cytokine predominantly secreted by monocytes and skin keratinocytes, assumes critical roles in immune responses, inflammatory regulation, hemopoiesis, and the differentiation of epidermal cells and keratinocytes. It plays a pivotal part in tissue remodeling and wound-healing processes, contributing to the restoration of epithelial layer homeostasis during infections and inflammatory responses, thereby maintaining tissue integrity. Notably, IL-20 impacts various actin-mediated functions in activated neutrophils, leading to the inhibition of phagocytosis, granule exocytosis, and migration. Its effects are mediated through the type I IL-20 receptor complex, comprising IL20RA and IL20RB, or, alternatively, through the type II IL-20 receptor complex, consisting of IL22RA1 and IL20RB. Functioning as an arteriogenic and vascular remodeling agent, IL-20 activates diverse signaling processes, including the phosphorylation of JAK2 and STAT5, as well as the activation of serine and threonine kinases AKT and ERK1/2. Additionally, it forms a 1:1:1 heterotrimeric complex with its primary high-affinity heterodimeric receptor IL20RA/IL20RB.
Verified Bioactivity
Measure by its ability to chemoattract BaF3 cells transfected with human IL-20R alpha and IL-20R beta. The ED50 for this effect is <0.2 ng/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q9NYY1-1 (L25-E176)
-
Molecular Construction
-
N-term
-
IL-20 (L25-E176)
Accession # Q9NYY1-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
IL20; Cytokine Zcyto10; Interleukin 20; Interleukin-20; ZCYTO10; Interleukin Family Protein; IL-20; Four Alpha Helix Cytokine; IL10D
-
AA Sequence
LKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
-
Predicted Molecular Mass
18.5 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)