1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-20
  5. Animal-Free IL-20 Protein, Human (His)

Animal-Free IL-20 Protein, Human (His)

Cat. No.: HY-P700111AF
COA Handling Instructions

IL-20 Protein, a pro-inflammatory cytokine secreted by monocytes and keratinocytes, crucially regulates immune responses, inflammation, hemopoiesis, and epidermal cell differentiation. It plays a pivotal role in tissue remodeling, wound healing, and maintaining epithelial homeostasis during infections. Additionally, it impacts actin-mediated functions in neutrophils, inhibiting phagocytosis and migration. Signaling through type I or II IL-20 receptor complexes, it activates JAK2, STAT5, AKT, and ERK1/2, forming a heterotrimeric complex with IL20RA/IL20RB. Animal-Free IL-20 Protein, Human (His) is the recombinant human-derived animal-FreeIL-20 protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free IL-20 Protein, Human (His) is 152 a.a., with molecular weight of ~18.47 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $60 In-stock
10 μg $170 In-stock
50 μg $480 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-20 Protein, a pro-inflammatory cytokine secreted by monocytes and keratinocytes, crucially regulates immune responses, inflammation, hemopoiesis, and epidermal cell differentiation. It plays a pivotal role in tissue remodeling, wound healing, and maintaining epithelial homeostasis during infections. Additionally, it impacts actin-mediated functions in neutrophils, inhibiting phagocytosis and migration. Signaling through type I or II IL-20 receptor complexes, it activates JAK2, STAT5, AKT, and ERK1/2, forming a heterotrimeric complex with IL20RA/IL20RB. Animal-Free IL-20 Protein, Human (His) is the recombinant human-derived animal-FreeIL-20 protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free IL-20 Protein, Human (His) is 152 a.a., with molecular weight of ~18.47 kDa.

Background

IL-20 Protein, a pro-inflammatory and angiogenic cytokine predominantly secreted by monocytes and skin keratinocytes, assumes critical roles in immune responses, inflammatory regulation, hemopoiesis, and the differentiation of epidermal cells and keratinocytes. It plays a pivotal part in tissue remodeling and wound-healing processes, contributing to the restoration of epithelial layer homeostasis during infections and inflammatory responses, thereby maintaining tissue integrity. Notably, IL-20 impacts various actin-mediated functions in activated neutrophils, leading to the inhibition of phagocytosis, granule exocytosis, and migration. Its effects are mediated through the type I IL-20 receptor complex, comprising IL20RA and IL20RB, or, alternatively, through the type II IL-20 receptor complex, consisting of IL22RA1 and IL20RB. Functioning as an arteriogenic and vascular remodeling agent, IL-20 activates diverse signaling processes, including the phosphorylation of JAK2 and STAT5, as well as the activation of serine and threonine kinases AKT and ERK1/2. Additionally, it forms a 1:1:1 heterotrimeric complex with its primary high-affinity heterodimeric receptor IL20RA/IL20RB.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with human IL-20R alpha and IL-20R beta. The ED50 for this effect is <0.2 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q9NYY1 (L25-E176)

Gene ID
Molecular Construction
N-term
IL-20 (L25-E176)
Accession # Q9NYY1
His
C-term
Synonyms
rHuIL-20; IL20; Cytokine Zcyto10
AA Sequence

MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE

Molecular Weight

Approximately 18.47 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-20 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-20 Protein, Human (His)
Cat. No.:
HY-P700111AF
Quantity:
MCE Japan Authorized Agent: