Animal-Free IL-25/IL-17E Protein, Human (His)

IL-25/IL-17E cytokines are produced by eosinophils, Th2 cells, and epithelial cells and critically regulate the adaptive immune response by modulating cytokine production. It enhances local and systemic type 2 helper T cell responses through its IL17RA and IL17RB receptors and activates the JAK2-STAT5A pathway. Animal-Free IL-25/IL-17E Protein, Human (His) is the recombinant human-derived animal-FreeIL-25/IL-17E protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-25/IL-17E Protein, Human (His) is 145 a.a., with molecular weight of ~17.68 kDa.

The cytokine Animal-Free IL-25/IL-17E, produced by various cells such as eosinophils, T-helper type 2 (Th2) cells, or epithelial cells, plays a crucial role in the internal safety of adaptive immune responses by regulating cytokine production. This cytokine promotes and augments T-helper type 2 responses both locally and systemically, acting through its receptor composed of IL17RA and IL17RB for signal transduction. Upon binding, Animal-Free IL-25 activates the JAK2-STAT5A pathway, leading to the secretion of type-2-associated cytokines, including IL4, IL9, and IL13. Additionally, it induces the release of IL8 and IL6 from eosinophils by simultaneously activating the MAPK and NF-kappa-B pathways. Notably, Animal-Free IL-25 inhibits the differentiation of T-helper (Th17) cells through the production of IL4, IL5, and IL13, contributing to its regulatory role in immune responses.

1.Measure by its ability to induce IL-8 secretion in human PBMCs. The ED₅₀ for this effect is <5 ng/mL.
2.Measure by its ability to induce CXCL1 secretion in HT29 cells. The ED₅₀ for this effect is <1 ng/mL

Human

E. coli

C-His

Q9H293 (Y33-G177)

64806  [NCBI]

MYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

Approximately 17.68 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.