Animal-Free IL-9 Protein, Human (His)

IL-9 protein, secreted by T-helper 2 lymphocytes, mast cells, or NKT cells, regulates immune response against parasites, intestinal permeability, and adaptive immunity. It induces differentiation of TH17 cells and mast cell proliferation through IL9R and IL2RG receptor stimulation, activating JAK1, JAK3, STAT1, STAT3, and STAT5. IL-9's diverse effects are mediated by its interaction with IL9R subunit and IL2RG. Animal-Free IL-9 Protein, Human (His) is the recombinant human-derived animal-FreeIL-9 protein, expressed by E. coli, with N-His labeled tag. The total length of Animal-Free IL-9 Protein, Human (His) is 126 a.a., with molecular weight of ~14.93 kDa.

IL-9 protein, a multifunctional cytokine primarily secreted by T-helper 2 lymphocytes, mast cells, or NKT cells, plays crucial roles in the immune response against parasites. Its impact extends to intestinal epithelial permeability and adaptive immunity. IL-9 further contributes to the differentiation of specific T-cell subsets, including IL-17 producing helper T-cells (TH17), and promotes the proliferation and differentiation of mast cells. Functionally, IL-9 exerts its biological effects through a receptor composed of the IL9R subunit and the signal transducing subunit IL2RG. Receptor stimulation rapidly activates JAK1 and JAK3 kinase activities, leading to STAT1, STAT3, and STAT5-mediated transcriptional programs. While the induction of differentiation genes appears to be mediated by STAT1 alone, the protection of cells from apoptosis depends on STAT3 and STAT5. IL-9 interacts with the IL9R subunit and IL2RG, forming a molecular basis for its diverse cellular effects.

Measure by its ability to induce proliferation in MO7e cells. The ED₅₀ for this effect is <0.25 ng/mL. The specific activity of recombinant human IL-9 is approximately >5 x10⁶ IU/ mg

Human

E. coli

N-His

P15248 (Q19-I144)

3578  [NCBI]

QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Approximately 14.93 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.01 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.