Animal-Free MIG/CXCL9 Protein, Human (His)

MIG, also known as CXCL9 protein, occurs as a cytokine that affects the growth, movement, or activation state of cells involved in immune and inflammatory responses. Specifically, it acts as a potent chemoattractant for activated T cells, coordinating their migration. Animal-Free MIG/CXCL9 Protein, Human (His) is the recombinant human-derived animal-FreeMIG/CXCL9 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free MIG/CXCL9 Protein, Human (His) is 103 a.a., with molecular weight of ~12.53 kDa.

MIG, also known as CXCL9 protein, emerges as a cytokine exerting influence on the growth, movement, or activation state of cells involved in immune and inflammatory responses. Specifically, it acts as a potent chemoattractant for activated T-cells, orchestrating their migration. MIG achieves its effects by binding to CXCR3, thereby contributing to the intricate regulation of immune cell behavior, particularly in the context of inflammatory reactions and immune system modulation.

Measure by its ability to chemoattract BaF3 cells transfected with mouse CXCR3. The ED₅₀ for this effect is <0.5 μg/mL.

Human

E. coli

N-His

Q07325 (T23-T125)

4283  [NCBI]

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Approximately 12.53 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.