Animal-Free NAP-2/CXCL7 Protein, Human (His)

NAP-2/CXCL7 protein (LA-PF4) triggers DNA synthesis, mitosis, glycolysis, cAMP accumulation, and hyaluronic acid synthesis. It contributes to the formation of plasminogen activator in human synovial cells and acts as a CXCR1/CXCR2 ligand together with variants such as NAP-2 (73). Animal-Free NAP-2/CXCL7 Protein, Human (His) is the recombinant human-derived animal-FreeNAP-2/CXCL7 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

NAP-2/CXCL7 Protein, also known as LA-PF4, exerts a range of biological activities including stimulating DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and the synthesis of hyaluronic acid and sulfated glycosaminoglycan. It plays a role in promoting the formation and secretion of plasminogen activator by human synovial cells. As a ligand for CXCR1 and CXCR2, NAP-2, along with its variants, such as NAP-2(73), NAP-2(74), NAP-2(1-66), and the potent NAP-2(1-63), acts as chemoattractants and activators for neutrophils. Antibacterial proteins TC-1 and TC-2 are released in vitro from activated platelet alpha-granules. Additionally, CTAP-III(1-81) exhibits higher potency than CTAP-III in desensitizing chemokine-induced neutrophil activation, while beta-thromboglobulin functions as a homotetramer.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <0.5 ng/mL.

Human

E. coli

N-6*His

P02775 (A59-D128)

5473  [NCBI]

Partial

AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.