Animal-Free SDF-1 alpha/CXCL12 Protein, Mouse (His)

The SDF-1 α/CXCL12 protein acts as a chemoattractant with specific activity on T lymphocytes and monocytes (excluding neutrophils). It activates the CXC chemokine receptor CXCR4, inducing a rapid and transient rise in intracellular calcium ions and promoting chemotaxis. Animal-Free SDF-1 alpha/CXCL12 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeSDF-1 alpha/CXCL12 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free SDF-1 alpha/CXCL12 Protein, Mouse (His) is 69 a.a., with molecular weight of ~8.97 kDa.

SDF-1 alpha/CXCL12 protein functions as a chemoattractant specifically active on T-lymphocytes and monocytes, excluding neutrophils. It activates the C-X-C chemokine receptor CXCR4, inducing a rapid and transient rise in intracellular calcium ions and promoting chemotaxis. Additionally, it binds to the atypical chemokine receptor ACKR3, activating the beta-arrestin pathway and acting as a scavenger receptor for SDF-1. Moreover, it binds to the allosteric site (site 2) of integrins, activating ITGAV:ITGB3, ITGA4:ITGB1, and ITGA5:ITGB1 in a CXCR4-independent manner. Acting as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion through the LYN kinase, it stimulates migration of monocytes and T-lymphocytes via CXCR4 and ACKR3, while decreasing monocyte adherence to ICAM-1-coated surfaces. The SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1-mediated adhesion of monocytes to ICAM-1 through LYN kinase. It plays a protective role after myocardial infarction and induces down-regulation and internalization of ACKR3. Crucially, SDF-1 alpha/CXCL12 is indispensable during embryonic development, participating in B-cell lymphopoiesis, myelopoiesis in bone marrow, and heart ventricular septum formation. It stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7, as well as the growth of stromal cell-dependent pre-B-cells. Existing in monomeric or homodimeric forms, the equilibrium is influenced by non-acidic pH, the presence of multivalent anions, and binding to CXCR4 or heparin. The monomeric form is essential for full chemotactic activity and resistance to ischemia/reperfusion injury, while the dimeric form acts as a partial agonist of CXCR4, stimulating Ca2+ mobilization without chemotactic activity, functioning instead as a selective antagonist that blocks chemotaxis induced by the monomeric form. It interacts with the N-terminus of ACKR3, integrin subunit ITGB3 via the allosteric site (site 2), and TNFAIP6 via the Link domain.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR4. The ED₅₀ for this effect is <0.5 ng/mL.

Mouse

E. coli

C-His

P40224 (G21-K89)

20315  [NCBI]

MGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Approximately 8.97 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.